(data stored in ACNUC7421 zone)

EMBL: CP001825.PE450

CP001825.PE450       Location/Qualifiers
FT   CDS_pept        complement(502660..504318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0453"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH2025 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41374"
FT                   /db_xref="GOA:D1CEL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41374.1"
FT                   /translation="MLKVSNISKSYDGHVVLQDISFVVSSGEHIGLLGANGSGKSTLLR
FT                   LIAGLEAPDTGSIWIDPNSRVAYLPQYPESDLELTVKESIDKALGGLYAVEEQISEIER
FT                   KLSYTDHASIEDLLDQYTKLREMFDLLGGYELEAKVDAVLKGLRFDGELDTPVSHLSGG
FT                   NKTKLSIAKVILSDANLLLLDEPTNYLDLSSLLWLEEFLSKSSKSYIVVSHDRRFLDKT
FT                   VESILELDKRTHSIRTWPGNYTAYNRLSTMEKAKALERYQDFKAETERIQQDIRRTKEQ
FT                   AKSTESKTNSDTARRLAKKVAAKAKARERRLERYLEENKVERPPREWSLDLRDLGKEAI
FT                   DDNRTILDIQGLTVEFDGKRVIDNLSLHLRGRDRVAILGPNGSGKSTLLKSILGLVPYK
FT                   GRITIGQGVRIGYISQDLLEVSGDERVIDIFRSRVSMHEVDARNYLHKFLFQGDEAIRP
FT                   ASHLSYGQRIKLALALITASAANFLVLDEPTSHIDMPAIESLEESLSSYTGPLLLVSHD
FT                   RYFLKEVGVNRLEVICNGKLITYSSLEEYEEVLHG"
     ttgttgaagg tcagtaatat aagcaaatcc tacgatgggc acgtagtgct acaggatata        60
     tctttcgtgg ttagttccgg tgagcatata ggcttgctag gagctaacgg gtcaggcaag       120
     tctaccttgt taaggttgat tgcaggtctg gaggctcctg atacaggtag catttggata       180
     gatcctaata gcagagttgc ctacttacca caatacccag aaagcgacct ggaacttaca       240
     gtaaaagaat ctatagataa ggctctaggg ggtttatatg ccgttgaaga gcagatatcc       300
     gagatagaaa gaaagctctc ttacaccgat catgcatcta tagaggacct gctggatcaa       360
     tacaccaaac tcagggagat gttcgattta cttggcggat acgaacttga agccaaagta       420
     gatgcagtat tgaaaggatt acgctttgat ggagagcttg atacacccgt aagtcatctt       480
     tcagggggaa acaagaccaa gctatctata gccaaggtaa tactctcaga tgcaaacctg       540
     ctactgctcg atgagcccac taactatctg gatcttagct cattgttgtg gttggaggag       600
     ttcctgtcta agagctcaaa gtcttatatc gtagtgtccc atgatcgccg attcctggat       660
     aaaacggtag agagcatcct cgaattggac aagagaaccc acagtataag gacatggccc       720
     gggaattaca ccgcttataa tcgactatcc actatggaga aagccaaggc cttggagaga       780
     tatcaggact tcaaagcaga gaccgagcgt atacaacagg acatccggag aaccaaggaa       840
     caggcaaaga gcactgagag caaaactaac agcgatactg cacgccgcct agccaagaag       900
     gtggcagcta aagcaaaggc tcgagaaaga agacttgaga ggtacctaga agaaaacaaa       960
     gtggagaggc ccccaagaga atggagctta gacctgaggg atcttgggaa agaggctatt      1020
     gatgacaaca ggacaatcct ggatatacaa ggactgacag tagaattcga cggcaaaaga      1080
     gtgatcgaca atctgtcgct tcatctcaga ggtagagatc gcgtcgcgat actaggtcca      1140
     aacggatctg ggaagagcac gctcctaaaa agcatcctag gtctagtccc ctacaaagga      1200
     cgcataacca taggacaagg agtaagaata ggatacatat cacaggacct tctagaggta      1260
     tcgggtgatg agagggttat tgacatcttt cggtcacgcg tgagcatgca cgaggtggat      1320
     gcgcgtaatt acctgcacaa gttcctgttt cagggagacg aagctattag accagcgagt      1380
     catctaagct atgggcagag gatcaaactg gccctagctc ttataacagc atcagcagca      1440
     aacttcctgg tactcgacga acctaccagt cacatagata tgccggctat tgaatctctg      1500
     gaggagtccc tgtcttccta cacaggcccg ctattactag tatctcatga tagatacttc      1560
     ctcaaagaag taggggtaaa caggctcgaa gttatatgta atggtaaatt aataacctac      1620
     agcagtcttg aggaatacga ggaggtgctc catggctga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page