(data stored in ACNUC7421 zone)

EMBL: CP001825.PE451

CP001825.PE451       Location/Qualifiers
FT   CDS_pept        complement(504564..505532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0454"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4411 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41375"
FT                   /db_xref="GOA:D1CEL9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL9"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41375.1"
FT                   /translation="MSIAVSIMIEGQNGLNWTRWQKIADAVENLGFAGLFRSDHFTNPE
FT                   PPELDSLEAWVSLTYLADQTQRIHFGPLVSPVSFRDPIMMARQAIAIDDLSGGRFILGV
FT                   GAGWQEREHRMFGYDLGDVPTRTRRFEEALQVIHLLLTSDSSVSFDGYFYKLREAILLP
FT                   RPSIVGGPPILVGGNGKKKTLPLAAKYARVWNGVWLSPEDFKDRSETLDELLAREGRSP
FT                   QDVRRTMMTNLLFAADDKELDQKIADLKRTRSELSNLSTLEAVRQIQKQNWIAGTPDLV
FT                   LEQLQAYEEAGLQEIMLQWWDFDHPERLQPFAETVLQPITR"
     gtgagcatag cagtatccat catgatagag ggccagaacg gcctcaactg gacacgctgg        60
     caaaagattg cagatgcggt cgagaatctg gggtttgcag gattgttcag atcggatcat       120
     tttaccaatc cggagcctcc agagctggac tctcttgagg catgggtttc actgacctat       180
     cttgctgatc agacgcagag gatacatttt ggccctctag tctctcccgt atccttcaga       240
     gacccaatca tgatggccag gcaggccata gctattgacg atcttagtgg cggacgcttc       300
     atactcggag ttggtgcagg ctggcaagaa cgagagcata ggatgttcgg ctacgatttg       360
     ggtgatgttc ccacacgtac tagaagattt gaagaagcac tgcaagtcat acacctactt       420
     ctcacaagcg attcgtcagt atcttttgat ggctacttct ataagctaag agaggcaatt       480
     ctcttaccca gaccaagcat agtcggaggc ccgcccatac tagtgggagg aaatggcaag       540
     aagaagacac tgcctctcgc tgccaagtac gcaagagtgt ggaatggtgt atggctttcg       600
     ccagaagatt tcaaggacag gtccgaaact ctggatgagc tcctggcaag agaaggaaga       660
     agcccgcagg atgttcgacg taccatgatg acgaacctgc tgtttgctgc cgacgacaaa       720
     gagctggatc aaaagatagc agatctaaag cgcacaagat ccgagctgag caatctaagt       780
     actttggagg cagtgcggca gatccaaaag caaaactgga tagcgggcac tccagatcta       840
     gtgctggagc aactgcaggc ttacgaggag gctggactac aggagataat gctccagtgg       900
     tgggatttcg atcatccgga aaggctacaa ccgtttgctg aaaccgtgct acaaccaata       960
     accagatag                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page