(data stored in ACNUC7421 zone)

EMBL: CP001825.PE452

CP001825.PE452       Location/Qualifiers
FT   CDS_pept        complement(505548..506951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0455"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: bsu:BSU16160 ATP-dependent protease ATP-
FT                   binding subunit; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41376"
FT                   /db_xref="GOA:D1CEM0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM0"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACZ41376.1"
FT                   /translation="MQDFTPRQIVKELDKYIVGQDKAKRALAVALRNRYRRQQLPPEIR
FT                   DEVMPKNLMLIGPTGVGKTELARRLSKLVDAPFIKVEATKFTEVGYVGHDVESIVRELV
FT                   ETSVNMVHMKAMDRVKEEAEKAANERLINYLVRQSPKYKVLQEELESLADSEQESAAAS
FT                   TKKVVLERKMKRQRKRMAQMLAERRLDDEIVEIEVDPDPDLYSVVDIFADIGDSDESED
FT                   ATPLFSLDQSNRKRSRKVSVAEARRILVQEEAQKMIDFDAVIDEGVQKAEQDGIVFIDE
FT                   IDKLISNGYDSNADVSGEGVQRDLLPIVEGSNVVTRYGTVKTDHILFIAAGAFHDSKPS
FT                   DLIPELQGRFPLRVELEDLDAEDLKAILVEPDNSLIKQYQALLGTEGVELEFTPDGIDE
FT                   IARFAHEMNLKMENIGARRLQTVMERVLEDVAFDATDLEDKHVRIDRAYVKARLENLIE
FT                   NEDLSRFIL"
     atgcaggatt ttacacctag acagatagta aaggaacttg acaagtacat agttggacag        60
     gataaagcta agagagctct agccgtagct cttcgcaacc gctaccgcag gcaacagctt       120
     ccacccgaga tcagggacga agtcatgcca aagaacctga tgctgatagg tcccacagga       180
     gttggtaaga ccgagctggc gcgaagacta agcaagctag ttgatgcccc gttcatcaag       240
     gtagaggcta ctaagtttac cgaagtggga tacgtaggtc acgatgtaga gagcatagtg       300
     cgcgagctcg tcgagaccag cgttaacatg gtccatatga aggccatgga tagagtcaag       360
     gaagaagcag agaaagctgc caacgagcga ctgatcaact accttgtcag gcaatccccc       420
     aagtacaagg ttctgcagga agagctggag agcctcgcag attcggagca ggaatctgct       480
     gcagcatcta ccaagaaggt cgtactcgag aggaagatga agcgccaacg caagcgcatg       540
     gctcagatgc tagcagaacg cagacttgac gatgaaatag tcgaaataga ggtggatcca       600
     gatcctgacc tctactcagt cgtcgatatt tttgctgata taggggactc tgacgagtct       660
     gaggatgcca ctccattgtt cagcctagat caatctaacc gcaagcgcag ccgaaaagtc       720
     tctgtggcag aggctcgcag gatattggtg caagaagaag cacagaaaat gatcgacttt       780
     gacgcggtga tagatgaggg agttcagaaa gctgaacagg atggcatcgt ctttatagac       840
     gaaatagaca agttgatcag caacggctat gactccaatg ccgacgtctc tggagagggc       900
     gtgcagaggg acctgctgcc aatagtagaa ggctctaacg tagtcacgag atacgggacc       960
     gtcaagaccg atcacatact tttcatagcc gctggagctt ttcacgacag caagccttcg      1020
     gatctgattc cagagcttca aggaaggttc ccactgagag tagagctgga ggacctggat      1080
     gcagaggacc tcaaagccat cttggtagaa ccggacaact cattgataaa gcagtaccag      1140
     gctctcttgg ggacagaggg tgtggagctt gaattcacgc ctgatggtat agatgagata      1200
     gcccgctttg cgcatgagat gaatctcaag atggagaata taggcgcaag aaggctgcag      1260
     actgtcatgg aaagagtgct ggaagatgtg gccttcgatg ctacagacct tgaggacaag      1320
     catgtacgga tagatcgagc ctatgtgaaa gctcgactag agaaccttat agagaacgaa      1380
     gatcttagca gattcatact gtag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page