(data stored in ACNUC7421 zone)

EMBL: CP001825.PE453

CP001825.PE453       Location/Qualifiers
FT   CDS_pept        complement(507015..507572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0456"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   aba:Acid345_0214 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41377"
FT                   /db_xref="GOA:D1CEM1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM1"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACZ41377.1"
FT                   /translation="MSHNPPMMRATTILAVLRDGLLAMAGDGQVTFGDSIFKHKARKVR
FT                   TLYDGKVLVGFAGAVADALTLFERFESQLQQYSGDLRRSAVELAKQWRTDRYLRPLEAE
FT                   LIVGDPGQLLLITGQGEVIEPDEGILAIGSGSVYALAAAQALLRHTNMDAEHITLEAMK
FT                   IAAELCIYTNDNITIETIRAEN"
     atgtcacata acccaccaat gatgcgcgca acaactatac ttgcagtgct tcgagatggc        60
     ctcctagcaa tggcaggcga tggacaagta accttcggcg attccatatt caaacataaa       120
     gctagaaaag ttcgcaccct atacgatggc aaggtcctgg taggcttcgc tggagcggta       180
     gcggatgccc tcaccttatt tgagaggttc gagtcccagc ttcagcagta cagcggcgat       240
     ctacgtagat ctgccgtgga acttgccaaa caatggagaa ccgataggta cctgcgccca       300
     ctggaggcag agcttatcgt gggagatcct gggcagctgc tgcttattac aggacaaggg       360
     gaggtcatag agccggatga aggcatcctg gctatagggt ctggcagcgt ttatgctctt       420
     gccgctgcac aggctctact taggcacact aatatggacg cagagcatat aaccctggaa       480
     gctatgaaga tagctgccga gctctgcatc tatactaacg acaatataac gatcgaaacc       540
     ataagggcag agaactaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page