(data stored in ACNUC7421 zone)

EMBL: CP001825.PE455

CP001825.PE455       Location/Qualifiers
FT   CDS_pept        complement(507908..509557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0458"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rpb:RPB_0220 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41379"
FT                   /db_xref="GOA:D1CEM3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM3"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACZ41379.1"
FT                   /translation="MEVTEIIGRLKNNLSSQHIEFTDQDIEKIVEYGFLQNVLLTEDIM
FT                   QGLPYDVIPEYVWHTSPLEVDRSPKDSGDRMAPVSTTSKLSKSGELLDLPLSELSEMVR
FT                   SRKVSPVELVQSCLDNIDKYDKRLNAFQLVLGDEALQQAKRAEEDIVRGEYKGPIHGIP
FT                   IAVKDLFALRDHPTTAGSRILQNWVPDYDSAVVERIKSAGGIVIGKTRMSEFAYSPGAN
FT                   NTIYGHTLNPWNNDKDAGGSSSGSGVAVATRMALVGLGSDTGGSIRIPAAHCGIVGLKP
FT                   TFGRISLFGAVPLSWSLDHGGPLVRYTSDLPLVMALLSGQDKRDPRTSPASEWPYGDKV
FT                   TNEDTRSLRVGVIGYTGSDDPIGTHDVVTCWMKGVRALEEAGSRVEEVDIPDLERLWVL
FT                   NGALIGVEAATYHTHWLRTNKEAYSEFARYRLMSAFAYGPNIFMRIQQARALLRSKLNH
FT                   LWDRFDVITTPVVRHPAPDAGTPSHTLYTGPFNFLGWPALSVPVGVSSEGTPVGMQLVS
FT                   APWREDLLLVCSNVVEAALGPLALSGDRESTQ"
     atggaagtca cagagattat agggcgcctc aagaacaacc tcagttccca acatatagag        60
     tttacagacc aggatataga gaagatagtg gagtacggat tcctgcagaa cgtgctcctt       120
     acagaggata tcatgcaggg gctgccttac gacgtaatac cagagtacgt ctggcatact       180
     tctcccctcg aagtagacag gtcacctaag gatagcggcg accggatggc accggtcagt       240
     accacttcta aactctccaa gagcggagag ctactagatc tgcctctgtc agaactatct       300
     gagatggtca ggagcaggaa ggtatcaccc gttgagctgg tccaatcctg cctggataac       360
     atagacaagt atgacaagag gttgaatgcc ttccagctcg tactaggtga tgaagccctg       420
     cagcaagcga agcgagcgga ggaagacata gtaagagggg agtacaaagg gccaatccat       480
     ggtattccca tagcagtcaa ggatctattt gcgctccgag atcaccctac tacagctggc       540
     tctcgaatac ttcagaattg ggtgccggac tatgactccg ccgtggtaga gcgcatcaaa       600
     agtgccggag gcatagtaat tggtaagacc aggatgtcgg agtttgcata ctctccggga       660
     gccaataata cgatatacgg ccatactctt aatccttgga acaacgataa ggacgctggg       720
     ggatcaagta gtgggtccgg ggtggcagtc gctacccgta tggcgctggt aggattggga       780
     tcggatacag gagggtccat acgcatacca gccgcacatt gcgggatagt cgggctgaaa       840
     cccaccttcg gcagaatcag cctgtttgga gccgtgcctc tatcctggtc cctggatcat       900
     ggggggccgc tagttagata tacctctgac cttccactgg taatggcatt gctttcaggc       960
     caagacaaga gagatcccag gacttcacca gcaagcgagt ggccctatgg agacaaggtt      1020
     accaatgaag ataccaggag tctaagagta ggggtgatcg gatacacggg tagcgacgac      1080
     ccaataggaa cacatgatgt agttacctgc tggatgaaag gggtaagagc actcgaagag      1140
     gctgggtctc gagtcgagga agtagatata cctgacctgg agaggctctg ggtgctgaac      1200
     ggagcactaa taggcgtaga ggccgctacc taccacactc attggttgag gaccaacaag      1260
     gaagcctata gcgagttcgc cagatacagg cttatgtcag cttttgcata cggtccaaac      1320
     atattcatga ggatacagca ggcaagagcc ctgcttagaa gcaagctaaa tcacttgtgg      1380
     gacagatttg atgtgatcac tacgccagta gtaagacatc cagctcctga tgctggaact      1440
     ccttctcata ccctttatac aggtcctttc aatttcctcg gctggccagc gctatcagtc      1500
     ccagttggcg tctcttccga aggcaccccc gtgggcatgc agcttgtgtc cgcgccgtgg      1560
     agggaagacc tcctcttagt atgcagtaac gttgttgagg cagccttagg accccttgcc      1620
     ctaagcggag atagggaaag cacacaatga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page