(data stored in ACNUC7421 zone)

EMBL: CP001825.PE456

CP001825.PE456       Location/Qualifiers
FT   CDS_pept        509705..510238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0459"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: sus:Acid_5737 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41380"
FT                   /db_xref="GOA:D1CEM4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41380.1"
FT                   /translation="MALIDMAEAKEIQVDEFERIFLSYWEEIYLYLYRMLRDSQEAEDA
FT                   AQETFLKLYSRPPAANSNYRAWLYKVASREGLNRIRSNNRRTRLISKIKSLWSNEVAPD
FT                   TTDIVLANAESVEVRDILARMRPQYAQVLLLRHHGLSYDEISKVTGISKNSVGTILVRA
FT                   EKQFATLLERGEGK"
     ttggccctta tcgatatggc cgaagctaaa gagatccagg ttgatgagtt cgagcgcatc        60
     ttcctttctt actgggaaga aatatatcta tatctctacc gtatgcttag agattctcaa       120
     gaagctgagg atgcggctca ggagaccttc ctgaagctct actcgcggcc tccagctgct       180
     aattccaact acagggcatg gttatacaaa gtggcctcaa gagaagggct gaacaggata       240
     aggtcaaata acaggagaac caggcttata tcaaagatta aatcgttgtg gtctaatgaa       300
     gtcgcaccgg atacaactga catagtgtta gccaatgctg agagcgtgga agttagggat       360
     attctggcca gaatgcgtcc acagtatgcg caagtgcttc tgctgcgaca tcatgggctt       420
     agctacgatg agatatctaa ggttacaggt atatccaaga actcagtagg tactatcctg       480
     gtacgtgccg agaaacagtt tgctaccctc ctggaaagag gagaaggaaa atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page