(data stored in ACNUC7421 zone)

EMBL: CP001825.PE457

CP001825.PE457       Location/Qualifiers
FT   CDS_pept        510235..511350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41381"
FT                   /db_xref="GOA:D1CEM5"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41381.1"
FT                   /translation="MRCPSEGDLRSMLDNYRQELWEHVRSCKACSRRLESISQRKQLSA
FT                   GKLLANNSANCSAQQSYRSFVSRVERSKNMEFSEFGRRNPRPVLALVALLVLLPVLVLL
FT                   TPIRSAAESLLNVMRVEKFTAITIDPSQLPFNIPAEKYQQKWNQQMAARFGKYDKADLQ
FT                   KELKEHNIRRVSSVDEASKAYKGPVATIPKQGSPEEIYVSGPESASFTIDLQKIRAELK
FT                   EAGIQGVTLPKQLDGKTFTLDVPSAVVMRYGQDDSGFVFVQGESPTLVIPEGVNMDYVR
FT                   QDILMTPGLPPDLVKQIQSIKDWQHTLVIPVPPGGDSKNVRIGRSEGLLVSDRTGEHNL
FT                   LLWKHDDRLYAIGGKISSEDAISIARSVVYP"
     atgagatgtc caagtgaagg cgatttaagg tcgatgctcg ataattaccg tcaggagctg        60
     tgggagcacg tacgatcatg taaggcatgt tcccggaggc tggagtccat atcgcagcga       120
     aaacagctct cagccggcaa gctcttagct aataactcgg ctaattgttc ggcccagcag       180
     tcctacagga gttttgtctc gagggtagaa aggagcaaga acatggaatt cagcgaattt       240
     ggtagacgaa atcctagacc agtgctggct ttggtggctc tattagtgtt gttgccggtg       300
     ctagtactgc ttacacctat aagatctgca gctgagtcgc tgcttaacgt tatgagggtt       360
     gagaagttca cagctattac tatagatccc tcgcagttgc cgtttaatat ccctgccgag       420
     aagtatcagc agaagtggaa ccagcagatg gctgcaagat tcggcaagta cgacaaagcc       480
     gacttgcaga aggagctcaa agagcacaat ataagaaggg ttagctctgt tgatgaggct       540
     tccaaggcgt ataaggggcc agtagctacc attccaaagc aggggtctcc cgaggagatc       600
     tacgtgtctg gtcctgagag tgccagcttc acaatcgatc tacagaagat aagggccgag       660
     ctaaaggagg ccggaatcca gggagttact ctgcccaagc agcttgatgg taagaccttt       720
     accttggacg ttcccagtgc ggtcgttatg aggtacgggc aggatgactc tgggttcgtc       780
     ttcgtgcaag gggaaagccc gacgctagtt attcctgagg gcgtaaacat ggactatgtc       840
     cgacaggaca tacttatgac tcctgggttg ccgcctgatc tggtcaagca gatccagagc       900
     ataaaggact ggcaacatac cttggtgata cccgtaccgc caggaggaga tagcaagaac       960
     gtgaggatag gtaggtccga aggccttctg gtctctgacc gcacaggaga gcataacctg      1020
     ctgctgtgga agcatgatga caggctctat gcgataggtg gtaagataag tagtgaagat      1080
     gccatatcta tagcaaggtc tgtggtatat ccttag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page