(data stored in ACNUC7421 zone)

EMBL: CP001825.PE459

CP001825.PE459       Location/Qualifiers
FT   CDS_pept        512351..513193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2141 ABC-type transport system,
FT                   putative ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41383"
FT                   /db_xref="GOA:D1CEM7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41383.1"
FT                   /translation="MRSLLIAKFTFKEALRKKLVIGVILLSIVFVALYVWGFSSLKNNF
FT                   DERIASGNPPPFSFEFFANALVLMGFYTVNFLCGVMAIFASVGSIASEIDNGTLHSIVP
FT                   KPIRRWEIVLGKWLGYAFMLAIYVLLMCAAVVITGKLIGDYVPPRYIYGSLLVVLVGIV
FT                   LLSITVLGSTLFSSLTNGIVVFMLYGVSLMGGIVKQVGEILDSSTLKNIGLATNLVIPS
FT                   DTLWRLASYVIQPRFSLQMGPTLLSSDTPPSNMMVVYAFAYITLALLIANWIFARRDL"
     atgaggtcgt tactaatagc taagttcaca ttcaaagagg ctctgagaaa gaagcttgtc        60
     ataggcgtca tattgctcag catagtgttt gtcgccctat atgtttgggg tttttcatct       120
     ctgaagaaca attttgatga gcggattgct tctggtaatc ctccaccatt tagctttgag       180
     ttctttgcga acgctctggt gctcatgggg ttctacacag ttaatttcct gtgtggagtg       240
     atggctatct ttgcctctgt ggggagcata gcctcggaga tagataacgg caccctgcac       300
     tctatagtcc ctaagcctat aaggcggtgg gagatagtgc tgggcaaatg gctgggttat       360
     gcgttcatgc tcgcgatcta cgttttgctt atgtgtgctg ccgtggtgat tacgggcaag       420
     ctcatcggag actacgtacc tcccaggtac atatatggct cgcttctggt agtgcttgtg       480
     gggatcgtgt tactgtccat taccgtgcta ggcagcactc ttttctctag cctgaccaac       540
     ggcatagtgg ttttcatgct gtatggggta tcccttatgg gtgggatagt aaagcaggta       600
     ggcgagatac tcgatagctc gactctcaag aacattgggc tggcaaccaa tctggtgatc       660
     ccaagtgata ctctttggcg attggcttct tatgttatac aacccaggtt ctccttacag       720
     atgggtccga ctcttctaag ctctgatacc ccacctagca acatgatggt agtctatgcg       780
     tttgcctata tcacactggc tttgctgata gctaactgga ttttcgcccg tcgtgaccta       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page