(data stored in ACNUC7421 zone)

EMBL: CP001825.PE46

CP001825.PE46        Location/Qualifiers
FT   CDS_pept        48272..48484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40970"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40970.1"
FT                   /translation="MNHSPEDRILEETLSKQKELIEFYKKAIKQSADQECKDLFKSLAK
FT                   SLDSDMTSVAEEIAKHRMERKLREQ"
     atgaatcata gtccagaaga cagaattctt gaggaaaccc taagtaaaca gaaggaactg        60
     attgaattct acaaaaaggc tataaagcaa tccgcagatc aagaatgcaa agatctattc       120
     aagagtttgg caaaatcact ggactcggat atgacctcag tagctgaaga gatagccaag       180
     cacaggatgg agagaaagtt gagagagcaa tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page