(data stored in ACNUC7421 zone)

EMBL: CP001825.PE460

CP001825.PE460       Location/Qualifiers
FT   CDS_pept        complement(513264..513764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0463"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU0538
FT                   HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41384"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41384.1"
FT                   /translation="MLNRNFWDPFREMIRLSEAMDRLFEESFVRPTSWMLGRGGETGYW
FT                   VPIDIVETDNDYIVKASLPGFKPEDIQVNITGETLTISGNYKAEEPKDARYVLRERCLG
FT                   SFSRTITLPVPVEADKAVAHFEHGELTLTLPKVEEVRTKQIKISVGEQPQLSSTAESAQ
FT                   PQA"
     atgctgaaca ggaacttctg ggaccccttc agagagatga ttagactgag cgaggctatg        60
     gacaggctct ttgaggagag ctttgttaga cccactagct ggatgctcgg cagaggcggt       120
     gagactggtt actgggtgcc aatagatatc gttgagacag acaacgatta catagtcaag       180
     gcttctctgc ctgggttcaa gcccgaggac atccaggtca acattacggg cgagaccctg       240
     acgatctctg gtaactacaa ggccgaggag cctaaggacg caaggtatgt actccgtgag       300
     aggtgcctag gttccttcag cagaacgatc actctgcctg tgccggttga ggcggacaag       360
     gctgtggctc acttcgagca tggcgagctg actctgactc tacccaaggt agaggaggtc       420
     aggacaaagc agatcaagat aagcgttggc gagcagcctc agctgagcag cacagcggag       480
     tccgctcagc cacaggcata g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page