(data stored in ACNUC7421 zone)

EMBL: CP001825.PE466

CP001825.PE466       Location/Qualifiers
FT   CDS_pept        complement(518538..519035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0469"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bam:Bamb_5585
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41390"
FT                   /db_xref="GOA:D1CEN4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN4"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACZ41390.1"
FT                   /translation="MEDFIPSIHDLIMSGQILLSLLLGGVIGFEREARNKPAGLRTHMM
FT                   VAAGTTAFTLASIYGFSMVSGQITRDPARVAAQIVSGIGFLGAGTIFRSGSSIRGLTTA
FT                   STIWLVASIGMLVGVGMYWLAIFTTVISTVVLSFMPAPIYKLERRLRVGEPSITPDDDD
FT                   EL"
     ttggaggact ttataccctc cattcatgac ctgataatga gtgggcagat actcctgtcc        60
     ctcctgttag gaggtgtcat aggcttcgag cgagaggcca gaaacaaacc agcaggactg       120
     cgcacccata tgatggtggc ggccggcaca acagccttca cgctcgcttc aatctatgga       180
     ttcagcatgg tcagtggcca gataaccagg gatccagcgc gcgtcgcggc ccagatagtg       240
     tcggggatag gattcctggg tgctggtacc atatttagat ctggttccag catcagagga       300
     ttaaccacag catccactat ctggctggtt gcatccatag gtatgctcgt aggggtagga       360
     atgtactggc tggcaatctt caccacggtt atatccacgg tagtgctaag cttcatgcca       420
     gcacccattt ataaactgga aaggcggctt agagtaggcg agccatcgat tacacctgac       480
     gacgatgacg agctgtag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page