(data stored in ACNUC7421 zone)

EMBL: CP001825.PE467

CP001825.PE467       Location/Qualifiers
FT   CDS_pept        complement(519071..520570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0470"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: gme:Gmet_1676 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41391"
FT                   /db_xref="GOA:D1CEN5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN5"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACZ41391.1"
FT                   /translation="MSKYVLALDQGTTSSRAIIFDQEGNIVSLAQRPIDQIYPHPGWVN
FT                   QDAEHIWEVTLSVMKEAVQQSQLGISQIAAIGITNQRETTILWDRATGKPVGPAIVWQS
FT                   RQTSHLVDDIFRRGKAERYQQITGLVPDAYFSATKILWMLEQDPEVRRRAEQGDLAFGT
FT                   VDSWLLWKLSGGKVHLTDYSNASRTMLFDINELEWSDELLADLNIPKHILPGLCDNSGI
FT                   ICHADSSILGAEIPVAGVAGDQQAALFGQTCFSPGEAKNTYGTGSFCLMNIGEKPTHSK
FT                   HKLLTTIAWGINGKVEYALEGSIFVTGAAVGWLRDGLGIIKTSEEVEQLASSVKDSGGV
FT                   FFVPALVGLGAPYWDQYARGTIIGITRSTTAAHIARATLEAIAFQTRDVVEAMIADSGI
FT                   DLHELRVDGGAVKNDLLLQIQADILGVPVVRPTMTEVTALGAAYLAGLATDVWADQQDL
FT                   KAHWKEDRRFEPSINADQRESLYSTWKRAVERACRWEKPTE"
     atgtccaaat atgtgcttgc cctggatcag ggcacaacat caagcagagc tataatcttt        60
     gaccaagagg ggaacatagt atctctagct caaagaccaa tagatcagat ctatcctcat       120
     ccaggctggg tcaatcagga tgctgagcat atatgggaag taaccctctc ggtgatgaag       180
     gaagcagtcc agcaatcaca gctgggcatc tctcagatag ctgctatcgg tatcaccaat       240
     cagcgagaga cgacgattct ctgggataga gccacaggca agcctgtagg cccagcgatc       300
     gtctggcaga gcaggcaaac atcccatcta gtggacgata tattcaggcg aggcaaggcg       360
     gagagatacc agcagataac tggacttgtg ccagatgctt acttctctgc caccaagatc       420
     ctctggatgc tggagcaaga ccccgaagtg cgcaggaggg ctgaacaagg tgatctggct       480
     tttggcacgg tagatagctg gctactatgg aagctttccg gaggcaaagt acatctcacc       540
     gattattcca atgcatctcg caccatgctc tttgatataa acgagctcga atggtctgat       600
     gagctattgg cagacttgaa tatccctaag catatactcc caggtttatg cgacaattcc       660
     gggattatct gccatgctga tagcagcatc ctcggcgctg agatccctgt agcgggagtg       720
     gctggagatc agcaagcagc cctatttggg cagacttgtt tttcacctgg ggaagcgaag       780
     aatacctacg gtacaggctc cttctgtctc atgaacatag gggaaaagcc tactcattca       840
     aagcataaat tgcttaccac tatagcttgg ggtatcaatg gcaaagtcga atatgctctt       900
     gaaggctcaa tatttgtcac cggagcagca gttggttggc tcagggacgg tttgggaatt       960
     ataaagacct cagaagaggt agagcagtta gcctcctctg tgaaagatag tggtggtgtc      1020
     ttcttcgtgc cggcgctggt gggactgggg gcaccatatt gggatcaata cgctcgtggt      1080
     acaataattg gtatcacaag aagcactaca gctgcgcata tagctcgagc taccctggaa      1140
     gcgatagcct tccagacaag ggatgtggta gaagctatga tcgccgattc cggcatagac      1200
     ctgcatgagc ttagagttga cgggggtgct gtaaagaacg acttgctcct acagatacag      1260
     gctgatattc ttggtgttcc agtggtacga ccgaccatga cagaggtaac tgcactgggc      1320
     gccgcctatc tggcaggatt ggcaaccgat gtatgggctg accagcaaga tctgaaggca      1380
     cactggaagg aagaccgtag atttgagcct tccatcaacg cagatcagag agaatctctc      1440
     tactcaactt ggaagcgggc tgtagaaaga gcttgtaggt gggaaaaacc cactgaataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page