(data stored in ACNUC7421 zone)

EMBL: CP001825.PE47

CP001825.PE47        Location/Qualifiers
FT   CDS_pept        48547..49023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0048"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: sat:SYN_02369
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40971"
FT                   /db_xref="GOA:D1CDG5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG5"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ACZ40971.1"
FT                   /translation="MRCPKCGSTRTRVTDSRETTNAIRRRRKCEDCGYRFTTYERIEQV
FT                   MPLVVKRDGTREEWDRNKLLTGIRLACNKRPVSYSTMQQIVDEIEEQFSGRQEVDSSEI
FT                   GQAVMKKLRVLDEVAYIRFASVYLRFHDVNGFIEAVEQVRRPQKPPEEQIPMNI"
     gtgcgttgcc ctaaatgtgg atctaccagg actagagtaa ccgactctcg agagactact        60
     aacgcgatcc gacgcaggag gaagtgcgag gattgtggct accgtttcac gacgtacgag       120
     aggatagagc aagtcatgcc tctagttgtg aagcgagatg gcactcgaga agaatgggat       180
     agaaataagc tactcacagg aataagactg gcatgcaaca aaagaccagt atcctactcc       240
     actatgcagc agatagtaga tgaaatcgaa gaacagttct ccggacgcca ggaagtagac       300
     agctcagaga taggccaagc tgtaatgaaa aagctccggg tgttggatga ggtggcatac       360
     ataagatttg catccgtata ccttagattc cacgatgtaa acggcttcat cgaggcagta       420
     gaacaagtaa gacgtccaca gaaaccacca gaagaacaga tccctatgaa catataa          477
//

If you have problems or comments...

PBIL Back to PBIL home page