(data stored in ACNUC7421 zone)

EMBL: CP001825.PE474

CP001825.PE474       Location/Qualifiers
FT   CDS_pept        complement(532244..533374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0477"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   xca:xccb100_3196 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41398"
FT                   /db_xref="GOA:D1CEP2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41398.1"
FT                   /translation="MTPNAQSFEVQERERLVRIYRSLTGDPDTAEDLAQEAIIEAWRNK
FT                   HKLHDPSGRWRWLSNIARKVYLRWSRDRARDYRRMEIVGQDLSNRLELMEDPELSIELE
FT                   REELATILDEALRHLPAETRSILLQHVVEGMPQADIARKLGISEGAVAVRIHRGKLLLR
FT                   KILLSRPDYVGIYNIGASPSSWQPTDIWCPFCGLDKLQGKLDPATDTFMMKCPTCTPSP
FT                   DDQLINGSNIGIARSYTTLNGALNKLMKEACEYYGQGLRTRRTQCLSCGTTIPLWIELA
FT                   PDSECPIKTSMHFITAICQHCQEESRSLLAGHALSLPQGRAFWKANKRIRMLPEQNVER
FT                   EGRKAAVTAFESVSRSAKYEVVYALDNYDILLINNR"
     atgacaccaa acgcacaatc atttgaggta caagagaggg aaaggctggt acggatctac        60
     aggagtctta ctggagatcc agataccgct gaagatctgg cacaggaagc cattatcgag       120
     gcctggcgca acaagcacaa gcttcatgac ccgtccggca ggtggaggtg gctgtccaat       180
     atagctcgta aggtttacct gcgatggtca agagataggg ccagagacta caggcgcatg       240
     gagattgttg gccaagattt gtccaacagg ctagagctca tggaggatcc ggagctgtcg       300
     atcgagcttg aacgtgagga gctagcaaca atacttgacg aagccttacg ccatcttccg       360
     gcagagacca gatccatcct cctgcagcat gtagttgaag gaatgccgca ggccgacata       420
     gctcgaaagc ttgggatttc cgaaggagca gtagctgtca gaatacacag aggcaaactg       480
     cttcttagaa agatactcct ctcccgaccc gattacgtag ggatctacaa cataggtgcc       540
     tcgccaagct catggcaacc cacagatata tggtgcccct tctgcgggtt agacaagcta       600
     cagggcaagc tggacccggc aaccgacacg tttatgatga agtgtcctac atgtaccccg       660
     tcacccgacg atcagctcat caacgggagc aatataggta tagcaagatc ctataccaca       720
     ctaaatggcg cgctcaacaa actcatgaag gaggcttgcg aatattatgg gcagggttta       780
     cgcactcgta ggacgcaatg cctaagctgt ggcacaacga tacctttgtg gatcgagcta       840
     gctccagata gcgagtgtcc aataaaaacc tccatgcact tcatcaccgc tatatgccag       900
     cattgccagg aggagagcag gtcgttgctc gccggccatg ctctcagttt gccccaaggc       960
     agggcgttct ggaaggccaa caagaggata cgtatgttgc ctgagcagaa cgtggaacga      1020
     gagggaagaa aagctgcggt cacagccttc gagagcgttt ccagatccgc aaaatatgag      1080
     gttgtatatg cgcttgacaa ctacgacatc ctactcatca acaaccgata g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page