(data stored in ACNUC7421 zone)

EMBL: CP001825.PE477

CP001825.PE477       Location/Qualifiers
FT   CDS_pept        complement(536919..537530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41401"
FT                   /db_xref="GOA:D1CEP5"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41401.1"
FT                   /translation="MTLWLKVRRAWICTITVLVTVLLIDLSKYLYLAIPNLLGGDMLKM
FT                   PMPLILGIAICIVLGWGLGSGNPPLEAVASRPTQLLDTTYTLAITLLSLILCIILHSIS
FT                   KADVILAAGRNVLGYAGIMLLGRSFLGSNAATVLPTGFAIIVAMLGQDQYGRTYDWAWP
FT                   LAGSEYKLSWVLAAILLIVGITCYLGRMTILNNSAWGNEN"
     atgactttat ggctcaaagt gcgccgtgct tggatatgca caataactgt tttggtgaca        60
     gtccttctaa ttgatctatc caagtactta tacctggcaa tacccaacct cctcggcggt       120
     gatatgctca agatgccgat gcctctaata cttggaatag ctatatgcat agttctgggt       180
     tgggggttag ggagcggaaa ccctcctcta gaggcagttg ccagtcgccc aacacagcta       240
     cttgatacaa cctatactct agctatcaca ctattaagcc taattttatg catcatattg       300
     cattcgataa gcaaagctga cgtcatcctt gctgccggac gtaacgtgct aggctacgca       360
     ggaattatgt tgttaggacg gagttttctt ggatcaaatg cagctaccgt tctacccaca       420
     gggttcgcga ttattgtagc tatgctcgga caagaccaat acggtagaac ctatgactgg       480
     gcttggccac tggcgggatc cgaatacaag ctgtcttggg tattggctgc gatactcctt       540
     attgttggaa ttacttgtta tttgggccga atgacaatcc tgaacaatag cgcttgggga       600
     aacgaaaact aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page