(data stored in ACNUC7421 zone)

EMBL: CP001825.PE481

CP001825.PE481       Location/Qualifiers
FT   CDS_pept        540383..540766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41405"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41405.1"
FT                   /translation="MAKISIPIPEVVWRNETFDIPEDKIQVVMEALQSRQEAIIKSVAQ
FT                   RNEEILHKLQSLNLSKQGISTSRRFLMLGSGMATGLLLVALLPKAVRSVRGSQQTVEQG
FT                   EQATSQENAGVRLERVEVPADTA"
     atggctaaga tctccattcc tatacctgaa gttgtgtgga gaaacgagac attcgatatc        60
     cctgaagata agatccaggt ggttatggaa gccctacaat ccaggcagga ggctattata       120
     aagagcgttg ctcaaagaaa cgaggagata ttgcacaaac tgcagtccct gaacttgagc       180
     aagcagggga tcagcacatc ccgcagattc ttgatgttgg gctcggggat ggccactggg       240
     ctattgctcg tggcactact tcctaaggcc gttcgcagtg tgaggggaag ccagcaaact       300
     gtggaacagg gcgagcaggc tacatcccag gaaaatgctg gggtaaggct cgagagggtg       360
     gaagtgcccg cagacacagc ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page