(data stored in ACNUC7421 zone)

EMBL: CP001825.PE482

CP001825.PE482       Location/Qualifiers
FT   CDS_pept        complement(540884..543019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0485"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bcy:Bcer98_2485 DNA topoisomerase I; TIGRFAM:
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41406"
FT                   /db_xref="GOA:D1CEQ0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ0"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACZ41406.1"
FT                   /translation="MANKLVIVESPTKAKTISRYLGRGYSIKASMGHVRDLPKSKLGVD
FT                   TEHDFQPQYLIPRDKSKTVKELKESVASAREVYLATDPDREGEAIAWHLIQATGMDTSK
FT                   ARRVVFHEITPDAVRNAMANPREIDMRLVDAQQARRVLDRLVGYNISPLLWKKVKRGLS
FT                   AGRVQSVALRLVVDREREIQSFVPVEYWTISADLAKQPAKGRKPSRKDQFRALLVRIND
FT                   EKVEISNEEQARAIIEALEGATYKVLEVKQREIQRKPAPPFITSTMQQEASRKLNFNAR
FT                   RTMSVAQSLYEGVSLGDEGDVGLITYMRTDSTNVATVAQEEARQVIAQLFGDKYLPEKP
FT                   PVYTKKAKNAQEAHEAIRPTSVKRHPDAIKQYLTSDQYKLYKLIWQRFIASQMANAIID
FT                   GTTVDIAAEPRSGGAPYIFRATGSVIKFDGFLVVYQEGKDDDQEEELGSKALPPMTEGE
FT                   VLNLIQLLPEQHFTQPPPRYTEASLVKALEEQGIGRPSTYAIILSTLQERYYVVKDGKA
FT                   LVPTELGMLVNDLLVEHFPDIVDVNFTSQMEEELDDIASGERAWVPVIKEFYGPFERKV
FT                   RIAEEEMQKVDIQDEPAGENCPNCGRPMVFKMGRYGKFIACSGFPECRTTKAIVNRTGV
FT                   QCPACRQGELVERRSRKGRRSIFYACDRYPDCEFTISAKPLPQPCPACGGLQVEDGKNG
FT                   QKCIRCDGQGNILQKSA"
     atggcaaaca aactagtaat agttgagtcg cctaccaagg ccaagacgat cagcagatat        60
     ttgggcagag gctactcgat caaagcctct atggggcacg tccgagacct ccccaagagc       120
     aagctgggag tagataccga gcacgacttc cagccacagt acctcatacc cagagataaa       180
     tcaaagacag ttaaagagct caaggagagc gtggcctcgg cacgagaggt gtatctagca       240
     actgaccccg atcgtgaggg ggaagctatc gcctggcatc tgatacaggc cactggtatg       300
     gacactagca aagcccgaag agtcgtattt cacgagataa caccagatgc agtacgcaac       360
     gccatggcta atcctcgcga gatcgacatg aggctcgtag atgctcagca agctcgaaga       420
     gtccttgacc gacttgtcgg ctacaatatc agccctcttc tatggaagaa ggtcaagaga       480
     ggactatcgg caggaagagt acaatcagtg gccctgagac tggtagttga tcgtgagcga       540
     gagatccagt cctttgtgcc agtagaatac tggaccatct ctgccgacct tgccaagcaa       600
     ccagcgaagg gcaggaagcc gagtcggaag gatcagttca gggccttact ggtaaggatc       660
     aacgacgaga aagtagagat ctccaacgag gagcaggcca gggcgataat cgaggctctg       720
     gaaggtgcca cgtacaaggt acttgaagtc aagcagcggg agatccaaag aaagcccgcg       780
     cctcccttta tcaccagcac catgcaacag gaggcatcca ggaaacttaa tttcaacgcc       840
     cgccgaacca tgagcgtggc ccagagtcta tacgaaggag tatcactggg cgatgagggt       900
     gatgtcggtc taataactta tatgaggacc gacagtacca acgtggctac tgtggctcag       960
     gaagaagcca ggcaggtcat tgcccagttg tttggggaca agtatctccc tgaaaagccg      1020
     ccggtataca ccaaaaaggc caagaacgct caagaagcac acgaggccat aaggcccacc      1080
     agcgtcaaga ggcatcctga tgccataaag cagtacctta catctgacca gtacaagctc      1140
     tacaagctta tatggcagag gtttatagcc agccagatgg ccaacgcaat aatagacggc      1200
     accaccgtcg atatagcagc agaacccagg agcggtggag ccccctatat cttcagagct      1260
     acaggctcgg taataaagtt cgatggcttt ttggtagtgt accaggaagg caaggacgac      1320
     gatcaggaag aggagctggg cagtaaggct ctgcctccta tgacagaggg agaggtgctg      1380
     aacctgatac aactgttgcc tgagcagcac ttcacacaac ctcccccgag atataccgag      1440
     gcatcgctgg tgaaggctct ggaggaacag ggtataggga gacctagcac ctatgccata      1500
     atcctctcca cgctgcagga aagatactac gtggtcaaag acggcaaagc attagtacca      1560
     acggagctgg gtatgctcgt caacgacctg ctggtcgagc acttcccgga catagtcgac      1620
     gtaaacttta catctcagat ggaagaggag ctagatgata tagcctccgg agagcgcgca      1680
     tgggtgccgg tgattaagga attttatggg ccgttcgagc gcaaggtgcg catagcggaa      1740
     gaagagatgc agaaggttga cattcaggac gaaccggcag gcgaaaactg tcccaactgc      1800
     ggcagaccca tggtcttcaa gatgggcaga tatggcaagt ttatagcctg ctctggtttc      1860
     cctgagtgcc gtacgaccaa ggccatagtc aaccgcacag gggtgcagtg cccagcctgt      1920
     cggcagggag aactggttga gaggcgttcc cgcaaaggca ggagatctat cttctatgca      1980
     tgcgacaggt atccagattg tgagttcacg ataagcgcca aaccccttcc acagccctgc      2040
     ccggcctgcg gtggcctcca ggtcgaagat ggcaagaacg ggcaaaagtg catcaggtgc      2100
     gacgggcagg gaaatatact gcagaaaagc gcttag                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page