(data stored in ACNUC7421 zone)

EMBL: CP001825.PE488

CP001825.PE488       Location/Qualifiers
FT   CDS_pept        546414..546956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0491"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bph:Bphy_1696 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41412"
FT                   /db_xref="GOA:D1CEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ6"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACZ41412.1"
FT                   /translation="MSDKPRLRQLKAKALKDFLRGVQRPEVDLVFLLQDLEDPVNVGAA
FT                   FRIADGCEASEIILTGKTPTPPDSTIAGVGRGAHRRIPWRYVEHADEALVELKGMGYMA
FT                   CAIEVAEGAVPYYSLKYPDRVCLVVGHEYHGVTTRTLSVCDNAVYIPMYGKIKSLNVHV
FT                   ALAVVAFHVLHQQLICG"
     atgagcgaca agcccaggtt acgccagctg aaggcgaagg cattgaagga tttcctgaga        60
     ggcgtgcagc gcccagaggt agacctggtt ttcctgctac aggatctgga agacccggtt       120
     aacgtgggcg ctgcttttcg catagctgat gggtgcgagg cctcggagat aatactaact       180
     ggtaagacgc cgactcctcc tgattcaacc atcgctggtg ttggcagagg agcgcacagg       240
     cgtatcccat ggcggtatgt ggagcatgct gacgaggctc tagttgagct caaagggatg       300
     ggatacatgg cctgtgctat cgaggtggct gagggagcag tcccttatta ttccttgaag       360
     tatccggaca gagtatgcct ggttgtaggg catgagtacc atggagttac gaccaggact       420
     ctatcggtct gtgacaacgc tgtgtacatc cctatgtatg gcaagataaa gtccttgaac       480
     gttcacgtgg cgttggctgt agtcgcgttt cacgtcctgc atcagcagct catctgtggc       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page