(data stored in ACNUC7421 zone)

EMBL: CP001825.PE489

CP001825.PE489       Location/Qualifiers
FT   CDS_pept        complement(546943..548385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41413"
FT                   /db_xref="GOA:D1CEQ7"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41413.1"
FT                   /translation="MLSQIIAPKNWVIVLLTGSESCLLYLAMLVFSSEPRFVPPMIWMW
FT                   LLGVIAYFIPRLFQGRSHELYAGMTISCFLATSVLSVKYLCYPQIAWSDADWIRDYLLS
FT                   LLGEGNLSVHNPGFVSLASIIIWLRQVLRNTPDSEDIEYYLRIAVIPISILTVIGIGRL
FT                   GNNPSVTSLIVLSLAGCYTLGIASLAVSNSFRQEGEELIGKGIVGRWLISSLFPIAILA
FT                   LLGIGLSLLLYSPQTSLIDILLKIVSTILGWILLIISLIVQLILVPVIYLIAKIFEPAL
FT                   NRLNLNPLPERPPRNAQEDLERIIRQRGEGLPQHTLEIALIVGVLLIVLFLLIRHRPSR
FT                   DKLTKASVQREHAYGDLELGKTLRNLLARLARRGKKMATDPLMFLLRDSRWRYTAEVRR
FT                   TYREVLGLYREIGKPRLPYETPLEHSTHQGLSSLVELADLYDLARYSRKPLTAQDAARA
FT                   RELAEEIRSKLRVETNSSSSHR"
     atgctcagtc agatcatagc ccccaaaaac tgggtaatag ttctgttgac aggatcggaa        60
     tcttgcttgc tttacctcgc gatgctggtc ttctcatctg agcctcgctt tgttccacct       120
     atgatatgga tgtggctcct gggtgtgatc gcctacttta tacctagact ttttcagggt       180
     cgtagccacg aattgtatgc aggcatgaca attagttgct tcctggcaac tagtgtgctc       240
     tcagtgaaat acctatgcta cccccagatc gcttggagcg acgccgactg gataagggac       300
     tacctgcttt cgctgctggg cgaggggaat ctgtctgttc ataatccggg attcgtatcc       360
     ctggcaagca tcatcatctg gttacggcag gtactaagga acactccaga ttccgaagat       420
     atcgagtact atctgcgcat tgccgtcata cccatctcaa ttctcactgt tatagggata       480
     ggaagactag gcaataaccc cagcgttaca tcgctgatag tactatccct ggcaggatgt       540
     tataccttgg gcatagcatc cttagccgta agcaactcct tccgccagga aggcgaagag       600
     cttatcggca aagggatcgt aggaagatgg ctaatctcct ccctattccc aatagccatc       660
     ctggcacttc taggcatagg cttatccctg ctgctgtact caccacagac atcgctgata       720
     gacatcctgt tgaagattgt ctctactatc ttgggatgga tattgctcat cattagcctg       780
     atagttcaat tgatcctggt accagtaatc tacctcatag ccaagatctt tgagccagcg       840
     ttgaacaggc tgaatctgaa ccctctaccc gaacgacctc ccaggaacgc tcaggaagac       900
     ctcgaacgta tcatcaggca acgcggtgag ggattacccc agcacacgct cgagatcgcg       960
     ctgatagtgg gtgtactgct gatagtcctg tttctgttga tcaggcacag gccatcccga      1020
     gataaactta ccaaggcaag cgtacaaaga gagcacgctt acggagacct ggaactgggg      1080
     aagaccctgc gtaacctgct ggcaaggttg gccaggcggg gtaaaaagat ggccacagat      1140
     cctcttatgt tcctcctcag agactccaga tggcgttaca ctgccgaggt aagaagaaca      1200
     taccgggaag tactagggct ctaccgggaa ataggcaaac ccaggctgcc ctacgaaacc      1260
     ccattggaac atagcactca tcaagggcta tcctcgcttg tagagctagc tgacctctac      1320
     gatctggcca ggtacagccg aaagccattg accgcacagg atgctgcaag agctagagaa      1380
     cttgcagagg agataagaag taagctaagg gttgaaacca actcatcttc tagccacaga      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page