(data stored in ACNUC7421 zone)

EMBL: CP001825.PE49

CP001825.PE49        Location/Qualifiers
FT   CDS_pept        complement(51642..52760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0050"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   sus:Acid_0874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40973"
FT                   /db_xref="GOA:D1CDG7"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG7"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ACZ40973.1"
FT                   /translation="MLMEVFSIVLGVCIILLAITDIVLTVLHIQGRSLIEWLFTRSLWS
FT                   LLRAIASPLPGRARHHVLSWGFPLMIAGLIGIWVCLLVVGYSLIYWPFISNDAYFSQTQ
FT                   YHQGFGGALYFSGVTLATIGYGDIHPRSTLLGFVAVTEGFSGFVVITMSVTFLLSVYPS
FT                   LLKKSSLASALNREVDGDISAVPMIARYIDAGNLEALYTRIADINKDLLEVIEAHRVHS
FT                   ALYYAHPFEPDRSLVRVLLIIRGIITALRFGLYDQSRKVGQPWNDPRILVLEDSFTYAL
FT                   AMFAESVYVASRQSEYSEEEVREYLRKDYRSLRHRLHDLGLVLSADDGAEEEYVRFRLS
FT                   VDPYINAYREHSGYTTSEVESKLELAAHPLKK"
     atgcttatgg aagtctttag cattgtttta ggtgtttgta tcatcttgct tgcaataaca        60
     gatatagttc tcactgtgct gcatatacag gggcgtagtc taatagagtg gttgtttaca       120
     agatctttgt ggtctctgct aagagcgatt gcatctccac tcccaggaag agctaggcat       180
     cacgtgcttt catggggttt ccctctgatg attgctggat tgattgggat ttgggtgtgt       240
     cttcttgtag tgggctattc ccttatatac tggcctttta tttctaacga tgcttatttc       300
     tctcaaactc agtatcatca gggttttggg ggagctttat atttcagtgg tgtcacactg       360
     gcgacaatag gctatgggga tattcatcca cgttctacgc tgttgggttt cgtagcagtc       420
     acagaaggtt tcagcggatt tgttgtaatt actatgtccg ttacctttct attatctgtg       480
     tatcccagct tactcaagaa gagtagcctt gcttcagccc tcaacaggga agttgatgga       540
     gatatatcag ctgttcctat gattgctaga tacatagacg cgggcaatct tgaagctttg       600
     tacacaagaa tcgcggacat caataaggat ctactagaag taattgaagc tcatagagta       660
     catagtgctt tatattatgc tcaccctttc gagcctgata gaagcttagt tagagtgctc       720
     ctcataataa gaggaatcat aaccgccttg cgctttggtt tgtatgacca atcgaggaag       780
     gttgggcaac cctggaatga ccctagaata ttggtactgg aagattcgtt tacatatgcg       840
     ttagctatgt ttgctgagtc cgtgtatgta gcctctaggc aatcagaata ctctgaagaa       900
     gaagtaagag agtatctgag aaaggactat agatcattga gacataggtt acatgatctc       960
     ggtctggtac tttctgcaga tgatggtgca gaggaagagt atgttcgatt tagactaagc      1020
     gtagatccat atataaatgc gtacagagaa cattctggat acactacaag cgaagtggag      1080
     agtaaattag agctggctgc tcacccattg aagaaatag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page