(data stored in ACNUC7421 zone)

EMBL: CP001825.PE490

CP001825.PE490       Location/Qualifiers
FT   CDS_pept        complement(548389..549585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0493"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   bcr:BCAH187_A3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41414"
FT                   /db_xref="GOA:D1CEQ8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ8"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACZ41414.1"
FT                   /translation="MQERHHVYWLICGLVLLLGGAIGRNIVITTLGLVLVGTVGVSWLW
FT                   SRYALRGIRFHRKVLNPKIFPGESTEIEMEVTNLKPLPIPELRIREYLDRSLIPSGTTS
FT                   RGPYGSNVHIWHHVSIGPLEKVRWRYKVTCTRRGYYRVGPILMKTSDPLGFFDSESHVP
FT                   ATSRILVYPRLVPIEQLAPQYRLPFEGSKTTPGVIVDPSNVVGARPFVPEDTRRQIHWR
FT                   ATARSSQLQSKIWRPLQAHSMVICLNLEGTTVPWVPPDIDSVELGISVAATLINQASQS
FT                   RWACGLIVNSLHPGTWNPVNIRPSRDQKAFMNMMEILAKIPAHESMKFTDVLARERRQF
FT                   PQEAIIVVITCVMTPGIEEQIHINRALGREVIVIDPKLAVTNSKQAAASAITENVRQD"
     atgcaggaaa gacaccacgt ctactggcta atatgcggtc tggtcttgct ccttggagga        60
     gctataggcc gcaacatagt gatcaccaca ctgggattgg tgctggtcgg cactgtagga       120
     gtctcctggc tatggtctcg gtacgcactc cgaggaataa gattccacag gaaggtcttg       180
     aatcccaaaa tcttccctgg ggaaagcacc gagatagaga tggaggtcac caatctcaaa       240
     ccactcccca tacccgagct acgtatccgt gaatacctag acagatcact gattccctcg       300
     gggaccacca gcagggggcc ctacggctcg aacgtacata tatggcacca cgtatcgata       360
     ggacctctag aaaaggtcag gtggcgttac aaagtgacgt gtactcgcag aggatattac       420
     agagttggcc ccatactgat gaagaccagt gatcctcttg gattctttga cagtgaatcg       480
     cacgttcctg ccactagcag aatacttgtg tacccaaggt tggtgcctat cgagcagcta       540
     gcaccccagt acaggctgcc gtttgaaggg agcaagacca cacctggtgt catagtagac       600
     cctagcaacg tggtcggtgc aagacccttc gtgcccgaag acaccaggag gcagatccac       660
     tggagagcca cggccagaag cagccaattg caatccaaga tctggaggcc actgcaggcg       720
     cacagcatgg tcatatgcct caatctggag gggacgacgg ttccatgggt acctccggat       780
     atcgatagtg tggagctggg cataagcgtg gctgcaacac tcataaatca ggccagccaa       840
     tcccgctggg catgcgggct gatagtcaac agccttcatc cgggcacatg gaaccccgta       900
     aacatcagac cgtcacgaga ccagaaagct ttcatgaaca tgatggagat acttgccaaa       960
     atcccagcac atgagagcat gaaatttaca gatgttctgg ctcgcgagcg tcgccagttc      1020
     ccacaggagg caataatcgt agtcataacc tgcgtgatga ctccggggat tgaagagcag      1080
     atccacatca atcgagcgct tgggagagag gttatagtta tagatcccaa gctggcggtc      1140
     accaatagca agcaggctgc agcctctgca attaccgaga acgtgaggca ggattag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page