(data stored in ACNUC7421 zone)

EMBL: CP001825.PE491

CP001825.PE491       Location/Qualifiers
FT   CDS_pept        complement(549592..550533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0494"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   bcr:BCAH187_A2274 methanol dehydrogenase regulatory
FT                   protein; magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41415"
FT                   /db_xref="GOA:D1CEQ9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEQ9"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACZ41415.1"
FT                   /translation="MSARELAEVIKQNVRRVLVGADKPTEMLLVALVAQGHVLIQDVPG
FT                   VGKTTLARALAKSIDTSFSRIQFTPDLLPSDITGAYYYNQRESQWLLREGPIFAGIVLA
FT                   DEINRAAPRTQSALLEAMQEGQVTIEGETRDLPSPFLVIATQNPIELEGTFPLPEAQLD
FT                   RFLLRISMGYPSREDEKRVLLTHSPQSIRHIEPVTSTRQILDATEEATAVTVEESIAEY
FT                   IVDLIRATREHPAVQLGGSPRAGTALLRASRALAALRGRDYVLPDDVKELAVPVLAHRL
FT                   VLTQESMLRGRSAEEILQEIIEQIQVPVEAEA"
     atgtcagcca gagagcttgc agaggtcata aaacagaatg ttcgaagagt ccttgtgggc        60
     gccgataaac ctactgagat gctgctggta gcgcttgttg cacaaggaca cgtgttgatc       120
     caggatgtgc ctggagtcgg gaagacaact ctggcgcgcg ccttggccaa gtccatcgat       180
     acctcattta gtcgtataca attcacccct gacttgcttc cttcagatat caccggagcc       240
     tactattaca accaaaggga atcccaatgg ttactgcgcg agggcccaat cttcgctggt       300
     atcgtcctgg cggatgagat caaccgagca gcacccagaa cccagtcggc tctgcttgag       360
     gccatgcagg agggacaggt caccatagaa ggggaaacca gagatttgcc ttctcccttt       420
     ctggtaatag ccacccagaa ccctatagag ctggagggta catttcctct tcccgaagct       480
     caacttgacc gcttccttct caggatatcc atgggctatc cgtccagaga ggacgagaaa       540
     agggtcttgc tgacccattc cccacagagc atcagacata tcgagcctgt tacatccaca       600
     cgacagatct tggacgccac cgaagaggca actgcagtca cggtcgagga atcgatagct       660
     gaatatatag tagacctaat aagagccacc cgagagcatc cagcagtgca actgggagga       720
     agtccaagag ccggtacagc actcctgcgg gcatcacgag ctctagctgc gctcagaggc       780
     agagattacg tcctcccaga cgacgtaaag gagctagcag taccagtgct ggcacacaga       840
     ttagttctca ctcaggagtc gatgcttcgt gggcgaagcg cagaggaaat actgcaggag       900
     ataatcgagc aaatacaggt gcccgtagag gcggaagcat ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page