(data stored in ACNUC7421 zone)

EMBL: CP001825.PE494

CP001825.PE494       Location/Qualifiers
FT   CDS_pept        555561..556034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41418"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41418.1"
FT                   /translation="MRFNIIDPVGTVSFVAPCHAMKVFTAACSQNPRSLQELLDYSESY
FT                   DPDLKRYVLHGLAVFDEHNTKENPEAIRNVLSSTAPEGTPPFRIIDNITREVSLMPVKA
FT                   GLVIFNLIAKRIIQVQNSYADIERKDRGRVRRNGKPTRMLFRYELPPDWQLVP"
     atgagattta acatcataga ccctgttggt accgtaagct tcgtggctcc ttgtcatgcc        60
     atgaaggttt ttacagctgc atgctctcag aacccgcgca gcctgcagga actgctcgat       120
     tattctgagt cctacgatcc tgacctgaag cgatatgttc tgcatggact ggcggtgttt       180
     gatgagcaca acaccaagga gaatccagag gctatcagga acgtcctctc cagcacagct       240
     cctgagggca ctcctccgtt caggattata gacaacatca cgcgcgaagt tagcctgatg       300
     cccgtaaagg ctgggttggt catattcaac ctgatagcca agaggataat ccaggtgcag       360
     aactcctatg cagacataga gaggaaagat aggggacgag tacgtcgcaa cggcaaacct       420
     accaggatgt tgttccgtta cgaactacct ccggactggc agctggtgcc ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page