(data stored in ACNUC7421 zone)

EMBL: CP001825.PE498

CP001825.PE498       Location/Qualifiers
FT   CDS_pept        559271..560119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0501"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: glo:Glov_3176 ParB-like partition protein;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41422"
FT                   /db_xref="GOA:D1CER6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER6"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACZ41422.1"
FT                   /translation="MSRPKGGLGRGLDALIPQTSSTFDNLVHIDQIIANPYQPRGSMDE
FT                   GRLQSLVESIKQNGILQPLLVQRQGDHYQLIAGHRRLHAAKMAGVQQVPVVIREARASD
FT                   NMLLLALIENLQREDLNPIDEAKAYRELQRKFGFSTDEIAERVGKSRPAVANALRLLEL
FT                   APEVKEMLIQGQISEGHARALLGLRDPQSQINTARLVVERGLSVRQTEQLVKRLRDNSG
FT                   QRSSQAIDPEVTYLEERFRQALGTKVSLSRSRRGGKLVIHFYSEEELQSIYEVIVGDRS
FT                   R"
     atgtccagac ctaagggtgg actaggaaga gggctggatg ctctcatacc gcaaaccagc        60
     agtactttcg ataatttggt ccatatagat cagatcatag ctaatcccta ccagcccagg       120
     ggctccatgg atgaggggag gctgcagtct ctggtggagt ccataaaaca aaatggtata       180
     ttgcagcccc tgctggtgca acggcaggga gatcattacc agctgatcgc cggccacagg       240
     cgccttcatg cagccaagat ggcgggcgtc cagcaggtgc ctgtggtgat ccgggaggcc       300
     agggcgagcg acaatatgct gctgctcgcc cttatcgaga atcttcagcg ggaagatctc       360
     aaccctatcg acgaggccaa ggcgtataga gagctgcaga ggaagtttgg cttctccaca       420
     gatgagatcg cggagcgagt aggcaagagc aggcctgctg tagccaatgc cctcaggctg       480
     ctggagcttg cgcccgaggt caaggagatg ttgatccagg ggcagatctc cgaggggcac       540
     gcccgagcct tgttagggct tcgcgatcct cagagccaga taaacactgc caggctggtg       600
     gtcgagcgtg gcctgagtgt caggcagacc gagcaactgg tcaagcgcct cagggacaac       660
     tctgggcaga gatcctccca ggctatagat ccagaggtga cctatctgga ggaacgcttc       720
     aggcaggctc tgggaacgaa ggtatccctt tcccgatcac gcaggggggg caagctagta       780
     atacatttct actctgagga ggagctacag tccatatatg aggtgatagt cggggacagg       840
     tcgagataa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page