(data stored in ACNUC7421 zone)

EMBL: CP001825.PE5

CP001825.PE5         Location/Qualifiers
FT   CDS_pept        3916..4698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0005"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bha:BH3101 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40929"
FT                   /db_xref="GOA:D1CDC3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACZ40929.1"
FT                   /translation="MEADTERFLQLQHMGNTLLITLNRPPVNAINLQVIEQLEEALTSY
FT                   EEDKNTKAVIITGNGRCFSAGADIKSFLEQDPDSPEIPLIRKANDVLNFIESYPKVVIA
FT                   AINGICLGGGNELALACDLRIASQNAIFGQPEIKLGLLPGWGGIQRLTRLLGKARALEM
FT                   CLTGESLNADRALQIGLVNEVVSPEGLIDRSLEISQKLSSLPTLAVNLIKQRIHKGAGA
FT                   SQGQAIREDEWAFRELLSSSYGQEGIKAFLEKREPRWD"
     gtggaggcgg atactgagag attcctacaa ctacagcata tggggaatac tctactaata        60
     accttgaaca ggccacccgt caatgccatc aaccttcagg taattgaaca gcttgaagaa       120
     gccctcacat catacgagga agataaaaac accaaagcag taattatcac tggcaatggc       180
     agatgcttct ccgctggagc agatataaag agctttctag agcaagatcc agattcacca       240
     gagataccgc ttataagaaa agcaaacgac gtacttaact tcattgagtc ctatcctaaa       300
     gtggtcatag cagctataaa cggaatatgc cttggcggag ggaatgagtt agctttagcc       360
     tgtgacctaa gaatagcctc acaaaacgct attttcggtc agcctgagat caagcttggg       420
     ctacttcccg ggtggggagg tatacaaagg ctgacgcggc tacttggtaa agctagagct       480
     ctggaaatgt gtctgacggg cgagtcccta aacgcagata gggctcttca gataggacta       540
     gttaacgagg tcgtgtctcc ggaagggctt attgatagat cgctagagat atctcaaaaa       600
     ctttccagcc tgccgactct tgcagtcaat cttataaagc aaaggattca caaaggggca       660
     ggagcttccc aagggcaagc cataagagag gacgagtggg cgttccgaga gctgctcagt       720
     tcatcttatg gtcaggaagg gatcaaagcc tttctggaga aacgagagcc tagatgggac       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page