(data stored in ACNUC7421 zone)

EMBL: CP001825.PE501

CP001825.PE501       Location/Qualifiers
FT   CDS_pept        562936..563637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0504"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH01980 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41425"
FT                   /db_xref="GOA:D1CER9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1CER9"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACZ41425.1"
FT                   /translation="MSHAEDLRVVLFDALGTLIEITSPVDVFQRVMADMGYDLTREQIR
FT                   AAIRRAHQWWMSPTRVPGSTSEAERADRQKYAAMFLEDLGIDHDSSLVDEVAERGNWAR
FT                   WVSVYPDVIPALEALGRDYTLVVVTNGGPSMCDAINYAGLGRYFQEVFASWSVGYQKPD
FT                   PRAYNVPLARLRYRPSQACFIDDTPENVAGALDCGIRAVLLDRKGEHQGWTGERVSSLV
FT                   EFASLLAKREV"
     atgagtcatg ccgaagatct aagagttgtt ctcttcgatg cacttggcac cctaatagag        60
     ataacttccc ctgtagatgt gttccagcgc gtgatggctg atatgggcta cgatctcacc       120
     agagagcaga tcagagctgc catacggcgt gcacatcagt ggtggatgag ccccaccagg       180
     gtacctggca gtacttccga ggcagagagg gcagatcgtc agaagtacgc agcgatgttt       240
     ctggaggatc tgggaatcga tcatgatagt tcgctggtcg acgaagtggc tgagagaggc       300
     aactgggcgc gctgggtaag cgtttaccca gatgttatcc cggctttgga ggctttggga       360
     agagattaca ctctcgtggt tgttacaaat ggtggaccat cgatgtgtga cgctatcaac       420
     tacgctggtc ttgggagata ttttcaggag gtgttcgcca gctggtctgt tgggtaccaa       480
     aagccggatc caagggccta caacgtaccg ctggccaggc tgaggtatag gcccagtcag       540
     gcatgcttta tagatgatac tcctgagaat gttgccgggg ctctggattg tggcatacga       600
     gctgtactgc ttgaccgtaa gggcgaacac cagggttgga ctggcgaaag agtctcatcg       660
     ctggtagaat ttgcctcttt gttggctaag agggaggtgt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page