(data stored in ACNUC7421 zone)

EMBL: CP001825.PE503

CP001825.PE503       Location/Qualifiers
FT   CDS_pept        complement(564183..565067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0506"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1866 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41427"
FT                   /db_xref="GOA:D1CES1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41427.1"
FT                   /translation="MTTKPQAARVRVAASPRKLSLSHIAERFLIYLLLSVLSFVFLVPF
FT                   FWLVSTSLKPRAQIFASNWIPDPIVWGNYAEVLRNTDFVLWTRNSLIVTFLAVVSVAFS
FT                   SALVAYPFAKMSFPLKGPLFALILATMMLPGAVTMVPTFLIWKKLNAVNTFYPLWAGNL
FT                   FGSAFYIFMLRQFFLTIPNDLKEAAIVDGASHLRIFWSVMLPLVKPAMLAVILFEFVAK
FT                   WNDYMTPLIYLNDPRKYTLPLGVATFMNSAGFETRWDLWMASSVLMTIPIIILFFMGQR
FT                   FFIEGIATTGLKG"
     atgaccacga aaccccaggc agctagagtc agggtagcag ccagtccaag aaagctctca        60
     ttgtcgcaca tcgcggagag atttctcata tacctgctcc tgtcagtcct gtcctttgtg       120
     tttctggtac ctttcttctg gctggtatct acctcgctca aaccacgagc tcagatcttt       180
     gcctctaact ggatacctga ccccatagtt tggggcaact acgcggaagt gctcaggaac       240
     acagatttcg ttctatggac ccgtaacagc ctcatagtga ccttcctggc ggtggtaagc       300
     gtggcgtttt caagcgcact ggtcgcttac ccctttgcca agatgagctt ccccctcaaa       360
     ggcccactgt ttgcgcttat actggcgacg atgatgctgc cgggcgcagt gacgatggtg       420
     ccaaccttcc tcatatggaa gaagctgaac gccgtgaaca ccttctatcc cctgtgggcc       480
     ggcaacctgt ttggatctgc cttctacata ttcatgttga ggcagttctt cctgaccata       540
     cccaacgacc tgaaggaagc cgccatcgtt gatggcgcat ctcacctcag gatcttctgg       600
     agcgtaatgc tgcccctggt gaagccggcc atgctggcag tgatactgtt cgagttcgtg       660
     gctaagtgga acgactacat gactccactt atatacctga acgacccaag gaaatatacc       720
     ctacccctgg gagtagctac cttcatgaac agcgcggggt tcgagacaag atgggacctc       780
     tggatggcca gctccgtgct catgaccatc ccgataataa tactcttctt catgggacag       840
     aggttcttca tagagggaat cgccaccaca ggcctcaaag gctag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page