(data stored in ACNUC7421 zone)

EMBL: CP001825.PE504

CP001825.PE504       Location/Qualifiers
FT   CDS_pept        complement(565064..565993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0507"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1865 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41428"
FT                   /db_xref="GOA:D1CES2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41428.1"
FT                   /translation="MRSVQAQRRYKKEEAITALLFISPWIIGFLVFTAGPMLASIYFSL
FT                   TEYNVLQPPEWVGLANYKEILTNDPLFWKSLYNTVYYTALYVPLHLAVALGLALLLNLN
FT                   VRGVPFWRTFFYLPSITPVVAVAILWRWILNPNSGILNRFLASVGLPTPGWTTDPNWMK
FT                   PALVLMSLWGAGGAMLIYLAGLKNIPRELYEAAQIDGAGRWARFLHITLPMISGVMFFN
FT                   LVISIIASLQTFAQPVLLFNTSEGGGSTTNDAVLLYIVYLFRQAFRYFHMGYASALAWI
FT                   IFVIIVIFTIIQFRLSQRWVYYEGGEQK"
     atgagaagcg tacaggctca gagaagatac aagaaagagg aggccatcac ggccctcctc        60
     ttcatatccc catggatcat tgggttcctg gttttcacag caggccccat gctggcgtcg       120
     atctacttca gtctcacgga atataacgtg cttcagccgc cggagtgggt aggtcttgca       180
     aactacaagg agatcctcac caacgacccg ctgttctgga agtccctcta caacaccgta       240
     tactatacag ctctgtatgt ccctctccac ctggcggtag cactggggct ggcgctgctg       300
     ctgaacctca atgtccgtgg cgtaccgttt tggcgaacgt tcttctacct gccctcgatc       360
     actccggtgg tcgctgtggc catcctgtgg aggtggatcc tcaatcctaa cagtggcata       420
     ctcaatcgct ttctggcctc cgtagggttg ccaactcccg gatggactac tgatcccaac       480
     tggatgaagc ctgcgctcgt gctcatgagc ctctgggggg ccggaggtgc catgctgatc       540
     tatttggccg ggctaaagaa catcccgaga gagctgtacg aggccgccca gatcgatgga       600
     gccgggagat gggccaggtt cctacacata accctgccta tgatctccgg agttatgttc       660
     ttcaacctag tgataagcat catcgcgtcc ttgcagacgt ttgcacagcc cgtactgctg       720
     ttcaacacct cggagggtgg tggaagcacc acgaacgatg ctgtactgct gtacatcgtc       780
     tatctcttcc gccaggcgtt tagatacttc cacatgggat atgcttctgc cctggcgtgg       840
     ataatcttcg tgataatcgt catcttcacg atcatacagt tcaggctgtc ccagcgctgg       900
     gtctactacg aagggggtga gcaaaaatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page