(data stored in ACNUC7421 zone)

EMBL: CP001825.PE505

CP001825.PE505       Location/Qualifiers
FT   CDS_pept        complement(566034..567578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0508"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcz:BCZK1634 sugar ABC transporter, sugar- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41429.1"
FT                   /translation="MNGHHNREQDQHKLSRRKVLQLGSKLAILTIGGPILASCGGGGGG
FT                   GTPTAGMTSPSPSPASPSPAAPGVTPEATPAASMAPSASPTPASTAATGATGWQVRFKE
FT                   QATITAWGFNTDNTTARVRVNLFKQTYPNIQLRLVPEITDQKILTAVASGQVPDLFWIG
FT                   RNSVISWAARGALEPLNDLIENDDRFNMDNFYESAVKEVTWDDQIWAIPQFMDVRALWI
FT                   NHKPLQEVGIKPDDVDPKNWNQLQQYGVKLTKKQGNRLTRWGFDHKVQDGYMWMWSWAN
FT                   NSNLLSEDGRTATFATPENIEALRYAAETIQKQGGWKAFDAFRQTWQWDAQHPVIQNQV
FT                   ALTLYESWLLGMIAEFAPDHPFNVIPFTDKSGKIVTAVGGLAWAIPKGAKNKEAAWEFI
FT                   SFMSDAQVWLRGAKAQANEEKGKYVPSLTANKEADKLLREQVYSPINDAIDSAVALFPR
FT                   LLNNSQAPPPSPVNAEINDILNNDAVLPALRGEKSPEDALKAAQEKAQAAIDKFFK"
     atgaacgggc accataacag agagcaggac caacacaaac tttcgaggcg caaggtactc        60
     cagttgggca gcaagctagc catactgacg atcgggggac caattctggc ttcctgcgga       120
     gggggcgggg gtggaggcac cccaaccgca ggcatgacat ctccatcgcc ctcgccggct       180
     tctccctcgc ctgcagcacc gggggtaact ccggaggcca ctcctgcagc ctccatggct       240
     ccttcggcaa gccccacacc agcctcgacc gccgccactg gcgctaccgg ctggcaggtg       300
     aggttcaagg aacaggccac gataaccgcc tggggcttca acactgataa cacaaccgcc       360
     agggtaaggg tgaacctgtt caagcaaact taccccaaca tccagctcag gctggtgccg       420
     gagatcacag accagaagat actgacagcc gtcgcgagcg ggcaggtccc ggacctcttc       480
     tggataggtc gtaacagcgt aatcagctgg gcggcaagag gggctcttga gccgttgaac       540
     gacctcatcg agaacgacga caggttcaac atggataact tctacgagtc ggcagtcaag       600
     gaggtcacct gggacgatca gatatgggcc atccctcagt tcatggatgt gagagctctg       660
     tggatcaacc ataagcccct gcaggaggtg gggataaagc ctgatgacgt tgatcccaag       720
     aactggaacc agctgcagca gtacggcgtg aagctcacaa agaagcaggg gaacaggctt       780
     accaggtggg gcttcgacca caaggtgcag gatggctaca tgtggatgtg gtcctgggcg       840
     aacaacagca acctgctgag tgaggatggc aggaccgcca cgttcgccac accggaaaac       900
     atcgaggcac tgcgatacgc cgctgaaacc atacagaagc agggaggctg gaaggcattt       960
     gacgccttca ggcagacgtg gcaatgggat gctcagcatc cggttatcca gaatcaggtg      1020
     gccctgacgc tctacgaaag ctggctgcta gggatgatcg ccgaatttgc tcctgatcac      1080
     cccttcaacg tcattccctt caccgacaag agcggcaaga tagtgacagc ggtaggtgga      1140
     ctggcctggg ctattcccaa gggagcaaag aataaggagg ccgcgtggga gttcatctcc      1200
     tttatgtcag atgcccaggt gtggctacga ggggcaaagg cccaggccaa cgaggagaaa      1260
     ggcaagtacg taccatccct gacggccaac aaagaggcgg acaagctcct gcgggagcaa      1320
     gtttactccc caattaatga cgctatagac tcggcagtgg cgttgttccc aaggctattg      1380
     aacaacagcc aggcgccgcc accttcaccg gtcaacgccg agataaacga catactgaac      1440
     aacgatgctg tactcccggc cctcaggggt gagaaatcgc ccgaggatgc cctgaaagca      1500
     gcgcaggaga aggcgcaggc ggccatagac aagttcttca agtag                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page