(data stored in ACNUC7421 zone)

EMBL: CP001825.PE506

CP001825.PE506       Location/Qualifiers
FT   CDS_pept        567707..568231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0509"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pla:Plav_1609
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41430"
FT                   /db_xref="GOA:D1CES4"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES4"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACZ41430.1"
FT                   /translation="MPVVSTRRGDDGFTNLWGSQRVPKYHDRPESYGTLDEANSFLGLA
FT                   RAMSNHQRVKTAIYEIQQDLYVMMAELATPDEDYEKSRYKITAEHVEKLDKLLEELKSQ
FT                   VELPRAFITPGDTMAGAALDVARTVIRRAERIIARLFHLEEISNQQVLRYLNRLSDVVW
FT                   VLGRYEEYQNR"
     gtgccggtag ttagtacacg cagaggtgac gatggcttca caaacctttg gggtagccag        60
     agggtgccca agtatcatga caggcccgag tcctacggga ccctggacga ggctaattca       120
     tttcttggcc tcgcccgtgc catgagcaat catcagaggg tgaagacagc tatctatgag       180
     atccagcagg acctgtacgt catgatggcc gagctggcca ctccggacga ggactatgag       240
     aagagcaggt ataagataac tgcagagcat gtcgagaagc tggacaaact gctggaggag       300
     ctgaaatcgc aggtggagct tcccagggcc tttattacgc ctggggatac catggccggg       360
     gccgcacttg atgtggccag gaccgtcata aggcgagcag agaggatcat tgcgcggttg       420
     ttccacttag aggagataag caaccagcag gtgctgcgct acctcaacag actgtccgac       480
     gtggtatggg tgctcggaag gtacgaggaa taccagaacc gctag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page