(data stored in ACNUC7421 zone)

EMBL: CP001825.PE507

CP001825.PE507       Location/Qualifiers
FT   CDS_pept        complement(568793..569008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41431"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41431.1"
FT                   /translation="MWPSDGRKQMMRKADALIEEARQKLGNGPEFIGWALDLQLRLRQA
FT                   AGKAYAETVLSDAHEETNHLPSNREM"
     atgtggccct cagacggacg caagcagatg atgcgcaaag cggacgcgtt aatcgaggag        60
     gccaggcaaa agctgggtaa tggcccagag ttcataggct gggcgcttga tctacaactg       120
     cgattgcgcc aggcagcagg caaggcctac gctgagaccg tactgtcgga tgctcacgag       180
     gagactaatc atctacccag caaccgggag atgtaa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page