(data stored in ACNUC7421 zone)

EMBL: CP001825.PE508

CP001825.PE508       Location/Qualifiers
FT   CDS_pept        complement(569745..570677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0512"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: psa:PST_1009 Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41432"
FT                   /db_xref="GOA:D1CES6"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES6"
FT                   /inference="protein motif:PFAM:PF01699"
FT                   /protein_id="ACZ41432.1"
FT                   /translation="MELLLAVLAVIAGMVLLEAGADKLTDAVQSLATRLRSSEAVVGLL
FT                   TVGGEWEELVVVVVAALTGHIEIGIGNIIGSCIANLAGSLPLGMLWSRKLIPDRAAKIY
FT                   SVVMLIATALATGVLWKGMNTGEGWLLVAAFVVYWSSLPLVIARGWLPSSAAEEESEEG
FT                   NSLVMLAIILASLLVLALGAELVVRGSAEIARRLGVSEYAIGATIVAIGTTLPDKAISL
FT                   VGGMKGSSGVVLANATGSNIFVLTLLLGLSAILGGAGGSSIGIDMWLLLGVSIAVTVMI
FT                   LRERLGRVEGALLLLFYAAYIAYALWRGA"
     atggagcttc tgctggctgt actggctgtc attgcgggca tggtcctcct ggaggcaggc        60
     gccgataagc tgacagatgc tgtgcagtcc ctggctacaa ggttgcgctc ttcggaagcc       120
     gtggtagggc tgctcactgt cggaggcgag tgggaggagc tggtggtcgt ggtggtcgca       180
     gccctgacag gtcatataga gataggcatc ggcaacatca tcggctcctg tatagctaac       240
     cttgcagggt cactgccgtt ggggatgtta tggtccagga agctgattcc cgacagagct       300
     gcaaaaatct actcggtagt aatgctgatc gcaacggcgc tggctactgg agtcctctgg       360
     aaggggatga acacgggaga aggatggctg ctggtcgcag cctttgtggt gtactggagc       420
     tccctgccac ttgtgatcgc ccggggctgg ctaccctcct cggctgccga ggaggaatca       480
     gaggagggca actcccttgt tatgctggcg attatcctgg cctcgctcct ggtactggct       540
     ctgggtgcag agctggtagt aaggggatct gcggagatcg cacgaaggct gggagtctct       600
     gaatacgcca taggcgccac catcgtcgcc ataggcacga cgctcccgga caaagctatc       660
     agcctggtgg gaggcatgaa gggtagctcg ggagtggtgc tggctaatgc cactggctcc       720
     aacatattcg tcctgacgtt gctgctggga ttgtcagcca tcctcggtgg agcgggtggc       780
     tcatcgatcg gcatagatat gtggttgctg ctcggggttt cgatagcggt gacggtcatg       840
     atactgcgag agcgtctggg acgcgtggaa ggtgccctgc tgctgctgtt ctacgcggcc       900
     tatatcgctt acgcgctgtg gagaggcgct tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page