(data stored in ACNUC7421 zone)

EMBL: CP001825.PE509

CP001825.PE509       Location/Qualifiers
FT   CDS_pept        570849..571358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0513"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   bbt:BBta_4537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41433"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D1CES7"
FT                   /inference="protein motif:PFAM:PF04314"
FT                   /protein_id="ACZ41433.1"
FT                   /translation="MQEMHPYESKHWLAKHIKRFAVLGTCLMPLLLLLAGCTTMAQGGP
FT                   PLTPASEDISVSGAWVRVVPGGTGSAYMTITNNGGAEDALIGVSTDIASSAMIHRTEVK
FT                   GGVASMTMVDRLPIPAHGKVELSPGGYHIMLEGLRQQLSPGDEVVLRLRFERAGEVMVR
FT                   AEVRRQ"
     atgcaggaaa tgcaccccta cgagagcaaa cactggcttg cgaagcacat caagcgcttt        60
     gctgtccttg gcacctgtct gatgccccta ctcctcctgc tggcgggctg caccacgatg       120
     gcacagggcg gcccgcctct cactcctgct tccgaagata tatctgtaag tggagcctgg       180
     gtacgagttg tgccgggcgg tacgggctcg gcctacatga cgatcaccaa caacggtggg       240
     gcggaggatg ccctgatcgg ggtctctacg gacatcgctt ccagcgcgat gatccaccgc       300
     accgaggtca agggaggtgt agcatctatg accatggttg atcgtctgcc gattccagcc       360
     catggcaagg tggagctatc acccggaggg tatcatatca tgctcgaagg gttaaggcag       420
     cagctctctc ctggagatga agtggtattg cgtctgcgct ttgaacgtgc aggggaagtc       480
     atggtgcgtg ccgaggtgcg caggcagtag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page