(data stored in ACNUC7421 zone)

EMBL: CP001825.PE51

CP001825.PE51        Location/Qualifiers
FT   CDS_pept        54946..55962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0052"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG: fatty
FT                   acid/phospholipid synthesis protein PlsX; K03621 fatty
FT                   acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40975"
FT                   /db_xref="GOA:D1CDG9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG9"
FT                   /inference="protein motif:TFAM:TIGR00182"
FT                   /protein_id="ACZ40975.1"
FT                   /translation="MRVAVDAMGGDKAPDEIVEGALRASNELGIDITLVGKEDVIAPLL
FT                   SSKPSQRHIEIIHTPEIIAMDEHPATAVRKKKDSSIVRGLELLKEGKADAFVSAGNSGA
FT                   VMAASLFVLGRCTGIDRPAIGTIIPGKEGPVLLIDAGANVDPEPVHLLQFAFMGSIYAR
FT                   EVMRIGNPKVGLLSNGEEETKGNKLTLQAHKLLKGSNLNFQGNVEGRDVTKGTVHVIVT
FT                   DGFTGNVVLKTVEGVAEDLVSIIREEITSGILNKVGALILQGAFRKVAQKLDYAEYGGA
FT                   PLLGVRGNVFIAHGRSNAKAIKNAIRLAHEAASHRIPKLISDNNIIVTGKEMFQQDL"
     ttgcgagtag ctgtcgatgc tatgggaggc gataaggccc cggacgagat agtcgaggga        60
     gctctaagag cgtcaaatga gctagggata gatattacct tggtagggaa agaagacgta       120
     atagcgccac tactgagcag taagccttcc caaagacata tagagatcat acatacacct       180
     gagatcatag ctatggacga acaccccgca acggcggtga ggaagaaaaa ggactcaagc       240
     atcgttcggg ggttggagct gctcaaagaa ggtaaggctg atgcttttgt ttcagctggc       300
     aattctgggg ctgtgatggc tgcttcccta ttcgtgcttg ggagatgtac gggcatagac       360
     cgccctgcta tcgggacgat aatacccggg aaagaaggcc cggtgctgct catagatgcg       420
     ggggcaaacg tagatcctga gcctgtacac cttctacaat ttgcgttcat gggaagtatc       480
     tatgctagag aagttatgag gattggtaac cctaaggtag gattactgag taatggagaa       540
     gaggaaacta aaggcaacaa actaacttta caggctcaca agttactcaa aggatctaac       600
     ctaaattttc aaggtaatgt agaaggtaga gacgtcacaa aaggaactgt gcatgtcata       660
     gtgactgatg gctttacggg gaacgtggtc ctgaaaactg tagagggtgt cgctgaggac       720
     ctggttagta ttataagaga agagataaca tccggcatac tgaacaaggt gggtgcatta       780
     atacttcagg gagcctttag aaaggtagcc caaaagctcg attacgcaga gtatggcggc       840
     gccccattac ttggagtcag agggaacgtc tttatagccc atgggcgttc taacgctaaa       900
     gcaataaaaa atgctatcag gctggcacat gaagcagctt cccataggat acccaagttg       960
     ataagtgaca acaatataat agttacgggt aaggagatgt tccaacagga tttgtga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page