(data stored in ACNUC7421 zone)

EMBL: CP001825.PE514

CP001825.PE514       Location/Qualifiers
FT   CDS_pept        577759..578133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41438"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41438.1"
FT                   /translation="MPGTAWASAEFALPRQATHHWVKLFMESMESGLPEPLEECPLPPA
FT                   PLPPLRGTAPGGVPLMEGTPHTTPLWIFHHAVVRESLCYGEGISPDLSLGAPQGWVYGV
FT                   FMEQTLHTAPSVGSPRDWVC"
     atgcctggaa ctgcctgggc gagcgctgag tttgcgctgc ccaggcaggc cacccaccac        60
     tgggtgaagc tcttcatgga gagtatggag agtgggctcc ccgagcccct ggaggagtgc       120
     cccctccccc ccgcccccct gccccccctc cgggggactg ccccaggcgg ggtgcctctc       180
     atggagggga ctccccacac cactcccctg tggatcttcc accacgcagt ggtgagggag       240
     tctttgtgtt atggagaggg gatctctcca gacctctccc ttggggcacc ccagggctgg       300
     gtgtatgggg tattcatgga gcagactctc cacaccgctc cctctgttgg atcacccagg       360
     gactgggtgt gttag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page