(data stored in ACNUC7421 zone)

EMBL: CP001825.PE515

CP001825.PE515       Location/Qualifiers
FT   CDS_pept        579071..579613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41439"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41439.1"
FT                   /translation="MADGEFGKRECRVGDWEGIAWMHSSPGKALGGVERQDPGDDRRDG
FT                   LEVVMPGRSTSPQGGDSAGQGQTSHDLFPISRSLNNREIGNKGCGALPGDGCRGAMRVM
FT                   RRRRLIEATEDWGTDLEGLDTGSLRTCEGGGGGMWCVVNPLPGMRVPCIWRVGGGVRWS
FT                   AGYTSRAALPGLQRVHL"
     ttggcggatg gggagttcgg aaagagggag tgcagggttg gagattggga ggggattgcc        60
     tggatgcact cgtcccctgg aaaggcacta ggtggcgttg agaggcagga tcctggggat       120
     gaccgcaggg atgggcttga ggtagtgatg cctggcagga gtacctcccc acagggtggg       180
     gacagtgcgg gccaggggca gaccagtcat gacttattcc cgatttcccg gtcccttaac       240
     aatcgggaaa tcgggaataa ggggtgtggg gctttgcctg gcgatgggtg caggggggct       300
     atgagggtga tgaggaggag acgcctgatc gaggctactg aggactgggg aactgacctt       360
     gaggggctgg acactggcag cttgaggacc tgtgaaggag gtggaggggg tatgtggtgc       420
     gtcgtcaatc ccctgccagg tatgagagtg ccctgcatat ggagagtcgg gggaggtgtg       480
     aggtggagcg ctgggtacac atccagggcc gcgttgcctg gcttgcaaag agtacactta       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page