(data stored in ACNUC7421 zone)

EMBL: CP001825.PE516

CP001825.PE516       Location/Qualifiers
FT   CDS_pept        complement(580253..581041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41440"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41440.1"
FT                   /translation="MHGPPASQATRPGVPAAIWDTWRVVIIYYICPTFAIGHCCLHAST
FT                   RAGQEDPQPGGLPSQCCLQASTTPGYTLLRRCKHTGPQGPPGSMVRLAGLSSHRGRSLQ
FT                   ALSDRGETGPLVSPIRHAPYPTSLQASPKHRTSTWDRSTLASSRACLGGQGAQEDPHEP
FT                   QGIHLPGSSLRPGAGEESGTHPSLLPPIAGHLHPQRPHVSPQGALEEHHQATRARGHAP
FT                   PLLDAQGALATISGVQASTSGTRTRGTLEPLPRTCPPGVM"
     atgcacggtc ctcctgccag tcaggccaca aggccaggtg ttccagcagc tatctgggat        60
     acgtggaggg tagtaattat atattatata tgccctactt ttgctatagg acattgctgc       120
     ctccatgcct ccaccagagc cggacaggaa gacccacagc ctggtggctt acccagccag       180
     tgctgcctcc aagcctccac tacaccaggg tataccctcc tcaggaggtg caaacataca       240
     ggtcctcagg gtccccctgg gagcatggtg cggctggcag gcctgtcctc acaccggggc       300
     agaagcttgc aggccctcag cgaccggggg gagacagggc ccctggtatc ccccataagg       360
     catgccccct accccacatc gctccaggca agcccaaagc acaggacgtc tacatgggac       420
     cgttcgaccc tggcatcttc ccgtgcttgc ctgggaggcc agggcgcaca ggaagaccca       480
     cacgagcccc agggcatcca tctccccgga agctcccttc gacccggagc aggtgaggag       540
     agcggtaccc acccctccct gctcccccca attgcgggac acctgcaccc ccagcgcccc       600
     cacgtgagcc cccagggggc tttggaagag caccaccagg ccacacgtgc ccgaggtcat       660
     gccccgcccc tgctggatgc gcaaggggcc ctggcaacga tctcgggggt acaggcgagc       720
     acctcgggca cgcgcacgag aggtaccctg gaacccctgc caaggacatg ccctccaggc       780
     gtgatgtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page