(data stored in ACNUC7421 zone)

EMBL: CP001825.PE518

CP001825.PE518       Location/Qualifiers
FT   CDS_pept        complement(581850..582086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41442"
FT                   /db_xref="UniProtKB/TrEMBL:D1CD25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41442.1"
FT                   /translation="MKGVMDWRGRARRIVSWGCRAGEGYAGATSSGDVGELGGAGASGQ
FT                   LPGQGTLEGKGEGIGAGRVCLPLAHLLRGCLCM"
     atgaaggggg tcatggattg gcggggaagg gctcggagga ttgtgagctg ggggtgcagg        60
     gctggggagg gatatgcggg agccacctcc tcaggggacg tgggggagct gggaggtgct       120
     ggagcctcgg ggcagctccc ggggcagggg accctggaag gcaaagggga agggataggg       180
     gctggaaggg tctgcctccc gcttgctcac ctgctccgtg ggtgcctgtg catgtga          237
//

If you have problems or comments...

PBIL Back to PBIL home page