(data stored in ACNUC7421 zone)

EMBL: CP001825.PE52

CP001825.PE52        Location/Qualifiers
FT   CDS_pept        55964..56734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0053"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; glutamine amidotransferase
FT                   class-I; KEGG: mxa:MXAN_5086 class I glutamine
FT                   amidotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40976"
FT                   /db_xref="GOA:D1CDH0"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH0"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ACZ40976.1"
FT                   /translation="MSAVIGIALSLDTGKNKIARFYGGLQYFRAIRSAGGVPVGLPLLD
FT                   EHTLRQAYDRMDGILLMGGGDVAPQRYGEKPIPELGDVEEYRDELELALIRWAREDNKP
FT                   LLAICRGIQILNVAYGGTLYQDIDAQNPTGLDHRLSTKTGKRSYIAHKMSIQEGTRLYR
FT                   SILEKEIPVNSMHHQAIKDVGKGLAVTGWSEDGIIEAVEDESNSWIVGIQCHPEELWEE
FT                   HLWAKRLFESFIREASFQANRRNPDRTIGALVKD"
     atgtcagcag taatcggaat agcactgtct ctggatacgg gcaagaacaa gatcgcaaga        60
     ttttatggag ggcttcaata ctttagggca atcagatcgg caggaggcgt gccagtagga       120
     ttaccattgt tggatgagca tacactacgt caagcatacg acaggatgga tgggatactc       180
     cttatggggg gaggggatgt agctcctcag agatacggtg aaaagcctat cccagagtta       240
     ggagatgtag aagagtaccg agatgagctt gagctagcac tcataaggtg ggcacgagag       300
     gacaataaac ctctgctagc tatatgccgt ggcatacaga tcttgaatgt agcatatggt       360
     ggaactctct accaggatat agatgctcaa aatcctacag gcttagatca caggctatca       420
     accaagacag ggaaaagaag ttacatcgcc cacaaaatgt cgatacaaga aggtacaagg       480
     ctttatagaa gcatcttaga gaaagagatt ccagtaaatt ccatgcatca tcaagctata       540
     aaagatgtgg gcaaaggact ggctgtcacg ggctggagcg aggatgggat aatagaggcc       600
     gttgaggatg agagcaactc ttggatagtg ggtatacaat gtcatcctga agagctatgg       660
     gaggaacacc tgtgggcaaa gcgcctgttt gagtccttca tcagagaagc tagcttccaa       720
     gctaataggc gcaaccctga cagaacaatt ggagcgttag tcaaggatta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page