(data stored in ACNUC7421 zone)

EMBL: CP001825.PE521

CP001825.PE521       Location/Qualifiers
FT   CDS_pept        complement(583404..583964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41445"
FT                   /db_xref="UniProtKB/TrEMBL:D1CET9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41445.1"
FT                   /translation="MQGHKPLFPISRFLSNREFGNFSPSPWRSAPAPPPPSGGLPQAGC
FT                   LSWRVVSPPHSPVDLPPRSGEGVFVLWRGDLSRPLPWGTPGLGVWGIHGADSPHRSLCW
FT                   ITQGLGVLGIHERGLSTPLLCGSPRAGCVRDSWRGGGRESPPLLSMASPPPTKLHHSAI
FT                   QGGRGEHMSALRCPALSQGPPLP"
     atgcaagggc acaaaccctt attcccgatt tcccggttct taagtaatcg ggaattcggg        60
     aatttctccc cgagtccctg gaggagtgcg cctgcccccc cacccccctc cgggggactg       120
     ccccaggcgg gatgcctctc atggagagtg gtctccccac cccactcccc tgtggatctt       180
     ccaccacgca gtggtgaggg agtctttgtg ttatggagag gggatctctc cagacctctc       240
     ccttggggca ccccagggct gggtgtatgg ggtattcatg gagcagactc tccacaccgc       300
     tccctctgtt ggatcaccca gggactgggt gtgttaggga ttcatgagag gggactctcc       360
     accccactcc tctgtggatc acccagggct gggtgtgtta gggattcatg gagaggaggg       420
     ggacgggagt cgccgcccct cctctccatg gcctcaccac cccccacaaa gctgcaccat       480
     agtgccatcc agggaggtcg tggagaacat atgagtgctc tgaggtgtcc tgctctgtcc       540
     cagggacccc ctctccccta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page