(data stored in ACNUC7421 zone)

EMBL: CP001825.PE522

CP001825.PE522       Location/Qualifiers
FT   CDS_pept        585449..586912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0528"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bcs:BCAN_B1216 arylsulfatase
FT                   D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41446"
FT                   /db_xref="GOA:D1CEU0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU0"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ41446.1"
FT                   /translation="MRVLYVDIDSLRPDHLGCYGYHRNTSPNIDSLAREAVVFQNCYIS
FT                   DAPCLPSRTALWSGRSGFHTGVVNHGGVASEPFREGPNRGHRDLFDRTGWMALLRSLGM
FT                   RTVTVSSFGERHSAWHWYAGFTEIYNPGKRGMDVADEVTPVAVDWLQRNAQSDNWFLHI
FT                   NYWDPHTPYRTPVEFENPFEGEPLPSWLTEEVRQRCWEGYGPHSAQEPSGWGQEDFHLR
FT                   YPRVPAQIDSMEAVRMWIDGYDVGVRYADEHVGRLLSVLDELRVLDETVVIIGADHGEN
FT                   LGELNVWGDHQTADQFTCRVPLIVRWPGLTSSPRVDRALHYQYDWAATLLELLGGQVPD
FT                   NWDGTSFAEAFRSGTEAGRPYLVISQNTWSCQRSVRFDNYICLRTYHDGYKQLQPLMLF
FT                   DLSRDPHEEHDLSGEMPQIVDRAMGMLEQWYSDMAATSLHDVDPMMTVLREGGPYYTRG
FT                   ELPAYIERLRATGRPHHAQALAARHRAEL"
     atgcgtgtgc tctatgtaga tatagatagc ctgcgtcctg accatctggg ctgctatggc        60
     taccacagga ataccagccc aaacatcgat tcgctggctc gcgaggcggt ggtcttccag       120
     aactgctaca tctccgatgc tccctgcctg ccttcacgca ctgctctgtg gagtggtcgc       180
     tctggttttc atactggcgt ggtcaatcac ggtggagttg cctccgaacc atttcgtgag       240
     ggcccgaatc gcggccaccg agacctgttc gacaggacag gctggatggc tctgctgcgc       300
     agcctcggca tgcgcaccgt caccgttagc tcctttggtg agcgacattc cgcatggcac       360
     tggtacgctg gctttactga gatctacaac cctgggaaga gggggatgga tgtcgctgat       420
     gaggttaccc ctgtcgcggt tgactggctc cagcgcaatg cccagtccga taactggttc       480
     ctgcacatca actactggga tcctcacact ccctaccgca cacctgtgga gttcgagaat       540
     cccttcgagg gtgagcctct gcccagctgg ctgacggaag aggttcgcca gaggtgctgg       600
     gagggctatg gtccacatag cgcacaggaa ccctctggct ggggtcagga agattttcat       660
     ctcaggtacc caagagttcc cgcccagatc gattccatgg aagctgtcag gatgtggata       720
     gacggctacg acgtgggtgt caggtatgcg gatgagcatg tgggcagatt gctgagcgtg       780
     ctggatgagc tcagagtcct ggatgaaacg gtcgtcatca taggtgctga ccacggcgag       840
     aacctggggg agctaaatgt ctggggagat caccagacgg cggatcagtt cacctgcagg       900
     gtgccgttga tagtccgctg gcctggtctt acgagctctc cgcgtgtgga tagagcactg       960
     cattatcagt acgactgggc ggctacgctc ctagagttgt tgggagggca ggtgccggat      1020
     aattgggatg gcacgtcctt cgctgaagcc ttcagatccg ggacagaagc tggccgtcca      1080
     taccttgtca taagccagaa cacctggtcc tgccagagat cagtccggtt tgataactat      1140
     atctgtctgc gcacctatca tgatggctac aagcagctgc agcctctgat gctgttcgac      1200
     ctctcccggg atcctcatga ggaacatgac ctgtcgggtg agatgcccca gatagtcgac      1260
     cgtgctatgg ggatgctgga gcagtggtac agcgatatgg ccgctaccag cctgcatgat      1320
     gtcgacccga tgatgacggt gctgcgggag ggtggtccct actacacccg aggagagcta      1380
     cctgcctaca tcgagcgcct gagagcgaca ggtcgtcccc accacgcgca ggcattggct      1440
     gccaggcacc gggcggagct ttga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page