(data stored in ACNUC7421 zone)

EMBL: CP001825.PE525

CP001825.PE525       Location/Qualifiers
FT   CDS_pept        589922..590296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41449"
FT                   /db_xref="GOA:D1CEU3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41449.1"
FT                   /translation="MSRVSAVLYSILISLFTLFVLLQVFFAGLAVFYTPVYWTWHITLV
FT                   HVFEWIPLFLIVFSLLGRMSAWARLSSIGLFLLLIVQYATANIREVPFISALHPVNALM
FT                   IFLIAILATYSSWREVLGGD"
     atgtcacgtg taagtgcggt gctctatagc atcctgatat cgctatttac gctcttcgtc        60
     cttttacagg tgttctttgc agggctggcg gtcttttata cccccgtgta ctggacctgg       120
     cacatcactc ttgtgcatgt gtttgaatgg atccctctgt tccttatagt gttctccctg       180
     ttagggcgta tgtctgcctg ggccaggtta tcctccatag gtttattcct gttgctgata       240
     gtgcagtacg caaccgccaa cataagagag gtccccttca tctcggcctt gcaccctgtg       300
     aatgcgttga tgatattcct gatagccatt ttggctacct actcttcgtg gcgcgaagtt       360
     ctgggagggg attga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page