(data stored in ACNUC7421 zone)

EMBL: CP001825.PE530

CP001825.PE530       Location/Qualifiers
FT   CDS_pept        complement(594422..596848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0536"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: afw:Anae109_2098 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41454"
FT                   /db_xref="GOA:D1CEU8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU8"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACZ41454.1"
FT                   /translation="MNNQEQPEANIPSLLPVLPLRDSVIYPFAVLPIVVGQERSIRLVD
FT                   DSMRSRRLIVLVAQRSRNVEQAGPDDIYRIGTVATIHHLVRAPDGTLRIVVQGVQRVRI
FT                   LDFISTQPYLVARIDPAPDQTENNVEEEALRRVAVDLFRRMVEISPDLPNEILPTLDSI
FT                   QDPIQTFYFIAGAIQLDVDTRQELLELEPLEVKLRRLVEILQKELSIREISQRIQSETQ
FT                   ERLTQAQREAYLREQLRTIQSQLGEGPEQSEVNELRRRIEEAGLPEEARKEAERELNRL
FT                   STIPMASPEYAIIRTYLEWLADLPWNKLSGGTIDTQRAREILDEDHYDLEKVKDRIIEH
FT                   LAVRKLREQRVSNLSGQEGTGEQNTIPSGSGDTLREPILCFVGPPGVGKTSLGQSIARA
FT                   LGRKFIRMSLGGIRDEAEIRGHRRTYIGAMPGRIIQGMRRVGTKDPVFMLDEIDKITVG
FT                   FQGDPAAALLEVLDPAQNHSFVDNYLGVPFDLSQVLFIATANTLDTIPAPLLDRMEVIQ
FT                   ISGYTEQEKLFIAQRYLIPKQMRAHGIQDSELRFTEESIRKIIREYTQEAGVRNLDRQI
FT                   ATICRKVARAIADGAAQSIEITPDNLQEYLGHPRHFHSTAERITRPGVATGLAWTPTGG
FT                   EILFIEATMMPDPHPRVILTGMLGEVMRESAQIALSYVRSEADPLGVNPDAFTGKTVHI
FT                   HVPAGAIPKDGPSAGLAIVAALASLGSSRLVRSDVAMTGEITLRGKVLPVGGIKEKVLA
FT                   AHRAGIKTVILPKENEQDLEDIPQELRDQMRFVLVDNIEDAMQVALTELPVLEET"
     atgaacaatc aggaacagcc ggaggctaat atacccagcc tgttgcctgt gctgcctcta        60
     agggattcgg tgatataccc cttcgcggtg ctgccgatag ttgtagggca ggaaaggtcc       120
     atacgcctag tagacgactc catgagaagc cgaaggctga tcgtattagt agcccaaaga       180
     agcaggaacg tcgagcaggc ggggccagat gatatctaca ggataggcac cgtagcaacc       240
     atacatcacc tggtcagggc acccgatggc acgctgagaa tagtggtaca gggcgtgcag       300
     cgggtgagga ttctagattt tatatctacc cagccctacc tggtggccag aatcgatcct       360
     gccccggacc agaccgagaa caacgtggag gaagaagccc tccgaagggt ggccgtcgat       420
     ctgttccgca ggatggtgga gatatcacca gacctgccaa atgagattct acccactctg       480
     gacagcattc aggaccctat ccaaaccttc tatttcattg cgggagccat ccagctcgat       540
     gtcgacacca ggcaggaact gcttgagctg gagcctctgg aagtcaagct aagaaggctg       600
     gtagagatcc tccagaagga gctgtcgata agggagataa gccagcgcat ccagagcgag       660
     acgcaggaga ggcttaccca ggcccagagg gaagcttacc tgagagaaca gttgcgtact       720
     atccagtccc agctgggaga aggtcctgag cagtccgagg tcaacgagct cagacgcagg       780
     atcgaagagg caggactacc cgaggaagcc agaaaagaag ccgaacggga gctgaacagg       840
     ctgtccacca tccccatggc ttcaccagag tacgctatca tccggacata tctggagtgg       900
     ctggcggacc tgccatggaa caaactctcc ggagggacca tagatacgca gagagccagg       960
     gagatcctgg acgaggacca ttacgacctg gaaaaggtaa aggacaggat aatagagcac      1020
     ctggccgtgc gcaagcttag agagcagagg gtaagcaacc tctctggcca ggaaggtacg      1080
     ggtgagcaaa acacaatacc ttcgggatct ggcgacacgc tgagagaacc aatactgtgc      1140
     tttgttggtc cgccgggtgt tggtaagacc agcctggggc agagcatagc cagggcgctg      1200
     gggaggaagt tcatccgcat gagcctggga ggcataaggg acgaagccga gatacgaggc      1260
     caccgcagga cctatatagg agccatgcca ggcagaatta tccagggtat gaggagggtt      1320
     ggcaccaaag acccagtatt catgctggac gagatagata agataacagt aggttttcag      1380
     ggagatcccg cagctgcgct gctggaggtc ctcgaccccg cacagaacca cagctttgtt      1440
     gataactatc tgggagtgcc gtttgatctc tcgcaggtac tgttcatagc tacggcaaac      1500
     acgctggata ccatccctgc gcccttgctg gacaggatgg aagtaataca gatatcgggc      1560
     tacaccgagc aggagaaact ctttatagcc caaagatacc tcatacccaa gcagatgcga      1620
     gctcacggca tccaggatag cgagctaagg ttcaccgagg aatccatcag aaagatcatc      1680
     agagaatata cacaggaggc aggagtcagg aaccttgaca ggcagatagc aacgatctgc      1740
     cgcaaggtgg ccagggcaat agcagacggt gcggctcagt ccatcgagat caccccggac      1800
     aatctgcagg aatacctggg acatcccaga cacttccata gcactgccga gaggataacg      1860
     cgacccggtg tggccactgg tctggcgtgg acacccacag gcggagagat cctgttcatc      1920
     gaagccacca tgatgccaga ccctcatccc agagtaatac tcacaggcat gctaggagaa      1980
     gtaatgaggg aatcagcgca gatagctctg tcctacgtcc ggtcagaggc tgaccctctg      2040
     ggggtgaatc cagacgcttt cacggggaag actgtgcaca tacacgttcc tgcaggggct      2100
     atacccaagg acggcccatc tgcggggctg gccatcgtgg ctgctctggc ttccctgggc      2160
     tcaagccggc tcgtacgcag cgacgttgcc atgactggtg agatcacgct gaggggcaag      2220
     gttcttccag tgggtggcat aaaagagaaa gtgcttgctg cccaccgagc ggggatcaag      2280
     acggtgatcc tccccaaaga aaacgaacag gacctggagg atatacccca agagctgagg      2340
     gatcagatgc gattcgtgct ggtagacaac atcgaggatg ccatgcaggt cgcattaacc      2400
     gagttgccgg tgcttgagga aacctga                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page