(data stored in ACNUC7421 zone)

EMBL: CP001825.PE531

CP001825.PE531       Location/Qualifiers
FT   CDS_pept        complement(596866..597288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0537"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: sal:Sala_0391
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41455"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEU9"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41455.1"
FT                   /translation="MRYRYLRYQYTISAPFDDLNVMSGLLGIRQPMFRLGSTVWRPMTD
FT                   ICETPRHINIIVELAGIKAEDIDVTLYENALVVEGERSINICGEDGVYRHAEIRHGPFR
FT                   LEIAIATSIDPEGVEANYDNGILRITLPKVAENNRS"
     atgcgctaca gatacctgcg ctaccagtac acgatcagtg ctccttttga tgatctgaac        60
     gtcatgagcg ggctgctggg catccggcag cccatgttcc gactgggctc cacagtatgg       120
     cggcctatga cggatatatg tgagacgcca agacatataa acatcatcgt cgagctcgcg       180
     ggtataaaag ccgaggacat agacgtcacc ctgtacgaga acgcgctagt ggtcgagggc       240
     gagagaagca taaacatctg cggggaggat ggggtgtacc gacacgccga gattcgtcat       300
     gggccattcc gactggagat cgccattgcc acgagtatag atcctgaggg tgtcgaggca       360
     aactacgata acggcatact tcgcatcacg cttcccaaag tagctgagaa caatagaagc       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page