(data stored in ACNUC7421 zone)

EMBL: CP001825.PE532

CP001825.PE532       Location/Qualifiers
FT   CDS_pept        complement(597317..598063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0538"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG:
FT                   aba:Acid345_0600 sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41456"
FT                   /db_xref="GOA:D1CEV0"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41456.1"
FT                   /translation="MTARVEASIREPEDFPREAIKYLRPLVNYARRRIRYYESTGELAP
FT                   GFVHPIEVVDQALVEALRRYRELPPDSPLYPWLRRFVRRVLNNLVREARQRRREISLEQ
FT                   PIGGNYDSDYLMERPIRLMDVLPDPTAPIPEEIIERREFQSALASIIGHLPESWREPFL
FT                   MHVVDGMSVEEIARIEGQKPEDIRYRIELARNYLKEMLTEEYEELEGSAPSEDIFSKVE
FT                   SMHLEDEQSRKIQQKLESATKDISKA"
     gtgacagcta gagttgaagc tagtataagg gaacctgaag atttcccacg agaggccatc        60
     aagtacctga gaccattggt aaactacgct cgcaggcgca ttagatatta cgaatcgaca       120
     ggcgagctcg ccccagggtt cgtgcatccg atagaggttg tagaccaggc ccttgtggag       180
     gcactgcgca ggtaccgaga gttacctcca gacagcccgc tgtacccatg gcttagaagg       240
     tttgtaagaa gagtactgaa caacctggtg agggaggctc ggcagaggcg cagggagatt       300
     tctctcgagc aaccgatagg aggtaactac gactccgact acctgatgga acgacctata       360
     aggctgatgg atgtactccc tgacccaaca gctccgatcc ctgaggagat aatagagagg       420
     cgggagttcc agtcagcgct ggccagcata attggtcatc tgcctgaatc ctggagggag       480
     ccattcctga tgcacgtggt tgatggtatg agcgtagagg agatagcccg catcgaaggg       540
     cagaaaccag aggacatacg ctacaggata gagctggcca ggaattacct caaggagatg       600
     ctgaccgaag agtacgagga gctggaaggg tctgcacctt ctgaggatat attctccaag       660
     gtggagagca tgcacctgga agatgagcag agcaggaaga tccaacagaa gctagaatct       720
     gctacaaagg atatatctaa agcctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page