(data stored in ACNUC7421 zone)

EMBL: CP001825.PE538

CP001825.PE538       Location/Qualifiers
FT   CDS_pept        complement(602523..603167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41462"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41462.1"
FT                   /translation="MSRKIISWLVVPLLVILLAGGILVAAALRSSQVPTRPGGGPTSAH
FT                   SPLIGLLIPKTDRKFGYGMLVPARWQAVDLGDRRAYVPPDSQHKSDRLVLTATNYRVLA
FT                   DRNKNLRVMQLELFRQHPDPVGWTKAIEMSWRDTGMRFQKESGLANGVIYSVRPAEDQM
FT                   QLVAFLVDAGQPMNLTMEGYGTYSSRETLVREGLLEDFQTMAQSLHAVDTK"
     atgagtcgca agattatctc atggttggtc gtaccgctac tggtgatcct gctggcagga        60
     ggcatcctcg tagcggcagc tctccgatca tcccaagtac ccacaaggcc aggaggaggt       120
     cccacgagcg ctcatagccc cctcatcggg ctattgattc ccaagacgga ccgcaagttc       180
     ggctatggta tgctcgtgcc agccagatgg caagcagtgg acctgggtga cagacgggcc       240
     tatgtgcctc ccgactccca gcacaagtcg gatcgtctcg tgctcactgc cactaactac       300
     agagtgttgg cagataggaa caagaaccta cgggtcatgc agcttgagct gtttaggcaa       360
     catcccgatc ctgttggctg gaccaaggcc atcgagatgt cttggcggga taccggtatg       420
     aggttccaga aggagagcgg ccttgccaac ggagtaattt actctgtgag gccagcagag       480
     gatcaaatgc agcttgtggc cttcttggtg gatgctgggc agccaatgaa tctgacgatg       540
     gagggatatg gcacctacag ttctagagaa acgctcgtga gggagggatt acttgaggac       600
     ttccagacga tggcccaaag cctacacgcc gtcgatacca aatag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page