(data stored in ACNUC7421 zone)

EMBL: CP001825.PE539

CP001825.PE539       Location/Qualifiers
FT   CDS_pept        complement(603182..603799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41463"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41463.1"
FT                   /translation="MRRAATVVGIVGAIALWAGFLVVCNRLGPAGVEPTSYYEGDVYAV
FT                   STSQAGPLRLLLWRVSYQPQQPLGRAIALTYTVVYLCLTNTGSSPVILYETREGSKGEP
FT                   PPPPPYYLLDDQGHRYPAVGAGWSWRTGEPEERFIGKALPGRTVDFTLDFNPIPTHVRH
FT                   LVLVMEDVRTQTGQSYDLRVEVPLPGEHEGQEGSTLVGCPGF"
     atgagaagag ctgcaaccgt ggttgggatc gtgggagcga tcgccctgtg ggcgggcttc        60
     cttgtggtgt gcaacaggct ggggccggca ggagtggaac ctacgagcta ctacgagggg       120
     gatgtgtacg cggtgagcac ttcacaggca ggtccactgc ggctgctgct gtggcgcgtg       180
     agctaccagc cccagcaacc actaggcaga gcgatagcgc tgacctacac tgtagtgtac       240
     ctgtgcctaa caaacactgg cagctccccc gtcatcctgt atgagacgcg tgaggggtcc       300
     aaaggagagc ctccacctcc gcctccctat tacctactgg acgaccaggg gcatcgctac       360
     ccggcagtgg gggctggctg gtcctggagg acaggagagc ccgaggagag gttcattggc       420
     aaagccttgc ctggcaggac ggtcgatttc acattagact tcaatcccat accgacacat       480
     gtcaggcatc tagtgctagt gatggaggac gtgagaaccc aaacagggca gagctatgac       540
     ctgcgggtag aggtgccgct gccgggggag catgaggggc aggaagggag caccctggtg       600
     gggtgccctg gtttctaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page