(data stored in ACNUC7421 zone)

EMBL: CP001825.PE54

CP001825.PE54        Location/Qualifiers
FT   CDS_pept        57312..58607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0055"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: bha:BH3556 enolase (2-phosphoglycerate
FT                   dehydratase); TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40978"
FT                   /db_xref="GOA:D1CDH2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH2"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACZ40978.1"
FT                   /translation="MAVIDDVYALEILDSRGNPTIQVTVVLDSGAYGTAAVPSGASTGA
FT                   HEAIELRDKDPIRFGGKGVLKAVSNVNEIIAETILGENVNSQRELDQILLELDGTPNKS
FT                   NLGANAILGVSLAFAHAMAADLNLPLYMYLGGAIARTLPVPMMNILNGGKHADNSTDMQ
FT                   EFMIMPIGASSFSEALRWGSEVYHALKKDLDNRGFNTNIGDEGGFAPSLDSNKTAIEAI
FT                   LRAIENAGYTPGEQIVIALDPAATELYQGGQYHLKKEGEVLTSSEMVDFWQEWIRQYPI
FT                   VSIEDGLAEDDWEGWTQLTEAIGNSVQLVGDDLFVTNTDRIREGIARRAANSVLIKPNQ
FT                   IGTLTETIEAVELAHKAGWTAIMSHRSGETEDTTIADLAVALGTGQIKTGAPARGERTA
FT                   KYNRLLRIEHELGDDAIYAGWSALRRKDLLSR"
     atggcagtaa tagatgacgt atacgcactg gagattttgg attccagagg taatccaact        60
     attcaagtaa ccgtagttct tgatagtggg gcctacggca cagctgctgt tccatcaggg       120
     gcatccactg gtgcacacga ggccatagag ctacgtgata aagatccgat tcgctttggt       180
     ggcaaagggg tgcttaaggc cgtatctaac gtgaacgaga tcatagccga gaccatactg       240
     ggagagaacg tcaactctca aagagaacta gaccagatac tactagaact ggatggtacc       300
     cccaacaaat ccaatctggg cgctaacgct attcttggcg ttagccttgc atttgcacac       360
     gctatggcag cagatcttaa tctacctcta tatatgtatc tcggaggcgc catagccagg       420
     actctccctg tgccaatgat gaatatactt aatggtggta agcacgcgga caacagcaca       480
     gacatgcagg aattcatgat catgcccatc ggtgcttcct ccttctcaga agcgctgagg       540
     tggggttctg aggtgtatca tgctctcaag aaggaccttg ataacagagg attcaatacc       600
     aacataggcg atgagggtgg ctttgctcct tcgctggact ccaacaaaac tgctatagag       660
     gccattctta gggcaataga gaacgctgga tacactcctg gagagcaaat agttatagct       720
     ctggatcccg cagctacaga gctttatcaa ggtggacagt atcacctcaa gaaagaaggc       780
     gaagttctca ctagctctga aatggtagac ttctggcaag agtggataag acaatacccg       840
     atagtctcaa tagaagacgg gcttgctgaa gatgattggg agggctggac acagctcacc       900
     gaggccatag gtaacagcgt acaactagtc ggagacgacc ttttcgtaac taatacagat       960
     cgcatcaggg aagggatagc tcgaagagct gctaatagtg tactgatcaa acctaaccag      1020
     ataggtaccc ttactgagac tatagaagcc gtggagcttg cccataaggc tggctggact      1080
     gcgataatgt ctcatcgtag cggagaaacc gaagatacaa ccatagcaga tctagcagta      1140
     gctcttggga caggacaaat caagactgga gcgcctgcca ggggtgaaag aacagccaag      1200
     tataatcgcc tactccgaat tgagcacgaa cttggtgatg atgctattta cgccggatgg      1260
     tctgctcttc gaaggaagga tttactgtct cgctaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page