(data stored in ACNUC7421 zone)

EMBL: CP001825.PE542

CP001825.PE542       Location/Qualifiers
FT   CDS_pept        complement(606428..606817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41466"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41466.1"
FT                   /translation="MSTEKVVEKLSKQVDRRRFLGIASKAALGFLLLLSSRRIQTAEAY
FT                   HTNCTNYNTVRTKYCCHLGYRDDCTSTESSNCFTYGTSHPSWWLWTCCYGTALVECREC
FT                   CKYSCSKAVLTPSCGSCGGTANVNC"
     atgtcaacgg agaaagtagt agagaagctc agcaagcagg tagatcggcg acgctttctc        60
     ggtatcgcta gcaaagcggc acttggcttc ttgttgctcc tctcgagccg tcgcatccag       120
     acagctgagg cctaccacac caactgcacc aactataata cagtcaggac aaaatactgc       180
     tgccatctcg ggtaccgaga cgactgcacg tctaccgaat caagcaactg cttcacttac       240
     ggcacctcgc accccagttg gtggctgtgg acctgctgtt acggcacagc acttgtcgag       300
     tgccgcgagt gctgcaagta tagttgctcc aaggccgtat tgacaccaag ctgtggatct       360
     tgtgggggca cagctaatgt taactgctag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page