(data stored in ACNUC7421 zone)

EMBL: CP001825.PE543

CP001825.PE543       Location/Qualifiers
FT   CDS_pept        complement(606870..607133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41467"
FT                   /db_xref="GOA:D1CEW1"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41467.1"
FT                   /translation="MKGQQSRPFSPWGHPLVEESLFCVLTRVHGLGRALAVAWVPLLFD
FT                   HRVTLLENLQGLRAYRPCLHRWHGYGLLVLALGLTIRCMLLH"
     gtgaaaggcc aacagagcag gccatttagc ccatgggggc acccactagt tgaggaatca        60
     ctattttgtg tgctaactcg agtccatggc ttagggcggg ccctggcagt agcgtgggtc       120
     ccgctactat tcgatcacag agtcaccctt ttggagaacc tccagggact gcgagcgtat       180
     cgtccctgct tgcatcgctg gcatggctat ggactgctcg tgctggcgct cgggcttact       240
     atcaggtgta tgctgctcca ttag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page